SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr D    

ID / Description / Sequence
1 >lcl|NP_001095286.2|Plus1complement(464575..465498) NW_003535898 cyclin-dependent kinase 5 activator 1 CDK5R1 __SEG__ Chr12 {Sus scrofa} MGTVLSLSPSYRKATLFEDGGATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPP
ASQLSGSQTGVSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDH
ELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGPEDKKRLLLGLDR*
2 >lcl|NP_001193822.1|Plus1104777..105364 NW_003535468 nucleosome assembly protein 1-like 5 NAP1L5 __SEG__ Chr8 {Sus scrofa} MADPENQGPAEPGQAAAAAAAAEAAAAVEEVMAEGGAQGGDSDSASGDSDGAVGQTAEEPQAPAENAPKPRNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQAL
EKKYNDIYKPLLAKIQELTGEMEGCAWTLEGDEEEDDEEEYEEEEEGEEEEEEEEEPAAEAAAGAAAAAAKDEGPHSAVSDDAKK*
3 >lcl|NP_999538.1|Plus1complement(117339..117848) NW_003534742 translationally-controlled tumor protein TCTP __SEG__ Chr5 {Sus scrofa} MIIYRGLISHNEMFSVVYQIREIADGLCLEVEGKMVSRTEDNIDDLLIGGNASAEGPEGEGTESTVITGIDIVLNHHLQETSFTKEAYKKYIKDYMRSIKLKNRDQKE*N
LL*QELQNKSSTSLLISKIISSLLVKT*IQTAWLLCWTTVRMV*LHI*FSLRMA*KWKNV
4 >lcl|XP_003123209.1|Plus11094887..1095126 NW_003534271 cyclin-dependent kinases regulatory subunit 2-like LOC100513396 __SEG__ Chr2 {Sus scrofa} MAPKQIYYLDKYFNEHYEYQHVMLPRELSKQIPQIHLMSEEEWRRLGVQQGLGWVHYMIHEPEPYILLLRQTLPKDQQK*
5 >lcl|XP_003126415.1|Plus1559192..559527 NW_003299939 prothymosin alpha-like LOC100516011 __SEG__ Chr5 {Sus scrofa} MSEAQAVGTSSEITTKDLQEKKEVVEEAKNEREAHSDGNASKKIGDQEADSEVDREEEEGGEEEEQEEEGDGEEEDGDEDEEADEATGKRAAEDDEDDSVDSKQQNTSED
D*
6 >lcl|XP_003135233.1|Plus161807..62976 NW_003301802 nucleosome assembly protein 1-like 2-like LOC100525624 __SEG__ ChrX {Sus scrofa} MMEEFGEQGAAGPLIGAAVQASPQALMGYSLDEDFIESLPLAVKYRVYALKKLQVKSAGLEAKYLREFHSIERKFAGIYGPLLEKRRQIINALYEPTKEECEVKSKAEDY
DANEVEDDCNAQMQGPEENPEYEDLEEYCEQDFEDMEEHFGEYEGLQGHNVDGEKEEPTGIPNFWLMALKNVEEVSPLIQKYDEPILKLLRDMKVKFSKPNEPPSFTLEF
HFEPNDYFTNEVLTKTYTLKSKLHYSDPHPFRGSAVEHCNGCKIDWKEGKNITVQRVLKKQRHKFWGLMRTVTQEIPRESFFNFFSALRWGLDADEDEEDVFIAHTLRTF
VIPRAVLYFTGEALETEQEGVIRECNDLFYDKVTHENGVAVVEGAKDQCLDSQAEDIDR*
7 >lcl|XP_003135234.1|Plus132339..33760 NW_003301802 nucleosome assembly protein 1-like 2-like LOC100525798 __SEG__ ChrX {Sus scrofa} MAESADYKELLESSQEEAGDKVMMEGPGEQPERGEDAAAGPGDDEERGEEAAAGPGEEGGKGEDAAAGSGEGGEKGEDTDEDSDADRPKGLIGYLLDTDFVESLPVKVKY
RVLALKKLQTRVANLESKFLREFHGIERKFAEMYQPLLEKRRQIINAIYEPTKEECEYKSDSEDCDDDEMYDEEELYGNEEGLLHEYMDEDDGCEEDYYDYVIENDKDDD
DADDDDDDDDDDDDGDDSEAARGENKEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNDLLTKTYVLKSRLAYYDP
HPYRGTAIEYCIGCKIDWNEGKNVTLKTIKKKQKHRIWGTIRTVTEDFPKESFFNFFTPQGINSDGKDGNDDFLLGHNFRTYIIPRSVLFFSGDALESQQEGVVREVNDE
IYDKIIYDNWMAAIEEVKACCKNLEAIVEDIDR*
8 >lcl|XP_003135408.1|Plus1complement(150639..152033) NW_001886682 DDB1- and CUL4-associated factor 12-like protein 2-like LOC100521308 __SEG__ ChrX {Sus scrofa} MAPQQTGSRKRKAPALEAAAAGSSSQGSAAAADGDGPLLPKKPKRPAARRSLLHYLKGREVGARGRAGLPGFEGELRGYAVQKLPELLRERELALGTLNKVFASQWLNAR
QVVCGTKCNTLFVVDVQSGQITRIPLMRDRAPGPARAQPSCGIHAIQLNPSKTLLATGGENPNSLAVYQLPTLDPVCLGDRHGHKDWIFAIAWMSDTVAVSGSRDGTVAL
WRMDPDVFQGSIAWHNNAGLPVYAHIRPRDVETIPRASTNPSNRKVRALAFSGKNQELGAVSLDGYFHLWKARSTLTRLLSIRLPYCRENVCLTYCDELSLYAVGSQSHV
SFLDPRQRQQNIRPLCSREGGTGVRSLSFYQHIVTVGTGHGSLLFYDIRAQKFLEEKAWATPHSSPGPAGRKLKLTCGRGWLNHDDLWVNYFGGIGEFPNALYTHCYNWP
EMKLFVAGGPLPSGLHGNYAGLWS*
9 >lcl|XP_003357131.1|Plus1complement(86778..87959) NW_003535467 tigger transposable element-derived protein 2-like LOC100624992 __SEG__ Chr8 {Sus scrofa} MRQKKAAGKGTKLKGDETAAREFCGNFQEFVERENLQPEQIYGADQTGLFWKCLPSRTLAFETEQSASGYRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGADL
SNLPVTYFSQKSAWIEHSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPAHPDEELLRSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGID
PRMFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGSEESSGMNIDEGAILAANLATVLQNTEDCEHVDLETIDQWFDSRSNDSSCQVLTDSEGAEDPAKPAEHKPS
SKTRRADLNPEKHISHKAALEWTENLLDYLEQQDDMLLSDKLVLRRLRTIIRRKQKIQNNKSR*
10 >lcl|XP_003359102.1|Plus1complement(904105..904608) NW_001885400 PIN2/TERF1-interacting telomerase inhibitor 1 LOC100154593 __SEG__ Chr14 {Sus scrofa} MCNGFSLFSTPQETSSPATPEGTETTTTTSAFTIHEYFAKRMAERKNKLQDTAEGPGVSETPLQSKRGKKRKKEAKDKSVENGTQPKAKKKRARAEWQLGDPGRDENSGV
SAEDREGSREVLSDQDFPLKPRRRKEKKKLPKPVEAAVAGMLEETPVKKKKKKKDSE*
11 >lcl|XP_003359700.1|Plus1complement(90930..>91766) NW_003536483 cyclin-dependent kinase 5 activator 2-like LOC100623529 __SEG__ Chr15 {Sus scrofa} DPLVQQRNRENLLRKGRDPPDGGGAAKNLAVPVPTVPTTAATCEPPSGGSAAAPQPGSGGGKPPPPPPPAPQAAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLK
ELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLN
ADPHFFTQVFQDLKNEGEAAAGSGGPPSGGAPAAPSSSSAARDSCATGAKHWTMNLDR*
12 >lcl|XP_003360439.1|Plus11346314..1347756 NW_003536825 nucleosome assembly protein 1-like 3-like LOC100519582 __SEG__ ChrX {Sus scrofa} MAEADPNRVSGAAAQGVDEEMVASSSSDSGEESDSSSSSSSSSSSTSCSSSSSSSSSNSRSRFYRKKRVPGPSRRARRAPSGRSFVDQLPRAVRNRVQALRNIQDECDKV
DALFLKAIHELERKYAELNRPLYDRRFQIINAEYEPTEEECEWNSEDEVFSSDEEVQEEGPSEMPALEGEEEEDPKPKPEVKAEENAAPKENPEAKAEERAESKDALEAK
PEVKEDPKEAPQAKAEDREQPKATEATKARVAVKEAPKRIPEVRPKERALKRARKGKPKREDPKGIPDYWLTVLKNVDKLGPMIQKYDEPILKFLSDVSLKFSKPGRPIS
YTFEFCFLPNPYFRNEVLTKTYIIKSKPDHNDPFFSWGWEIQDCKGCKIDWRRGKDVTVTTARSRTTATGEVATQPRVVPNASFFNFFSPPEIPTIGKLEPREDAILDED
FEIGQILHDNVILKSIYYYTGEVKDTYDVGKDYGNRKYRK*