SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor D    

ID / Description / Sequence
1 >lcl|NP_001002855.1|Plus12770125..2770439 NW_047332 protamine 3 Prm3 __SEG__ Chr10 {Rattus norvegicus} MGSRCAKLSTGHGPAQNTGHSRGHESSMKKLVACVSQDNFSLSSEGEEEEEDEEDEEEEDDDEEDEEEEQIPVKGKLLLLEPEKQDGAEDAVAQPSPEPKQKHS*
2 >lcl|NP_001019499.1|Plus1923230..924111 NW_047691 GTPase, IMAP family member 7 Gimap7 __SEG__ Chr4 {Rattus norvegicus} MAELDDDSLRIVLVGKTGSGKSATANTILGQKIFTSRIAPHAVTQTCQKASRRWKERDLLVVDTPGLFDTKVNLETTSIEISRCVLQSCPGPHAIILVLQLNRFTIEEQE
TVTRIKAIFGKAVMKYLIILFTRKDELEDQNLNDFIEDSDTNLKSIIKECDSRYLAINNKAEGAEGEMQVQELMGFVESLVRSNGGLYFSDPIYKYAEQRLKKQVGILRE
IYTDVLEKEIRIVEEECGLGKLSTQEGEEKIQAIREKYNLKIGNLREAAEKNIFTWIVEEVKKVLLKIWHFFS*
3 >lcl|NP_001019960.1|Plus1complement(2642608..2643993) NW_048043 nucleosome assembly protein 1-like 2 Nap1l2 __SEG__ ChrX {Rattus norvegicus} MAESAEHKELSDSNQEELGSQVMAEGPGGSQDCSEGVSTEPGDGGQQGEETVAAGVEEEGKGEEAAAGSGEDAGKRGGAAEDSDSDRPKGLIGYLLDTDFVESLPVKVKY
RVLALKKLQTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEYKSDCEDYFEEEMDEEEETNGNEEGMVHEYVDEDDGYEDCYYDYDDEEEEEEE
EDESAGATGGEAVNEEDPKGIPDFWLTVLKNVEALTPMIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLACYDPHPYRGTAIEYAT
GCHIEWNEGKNVTLRTIKKKQRHRVWGTVRTVTEDFPKDSFFNFFSPHGISLNGGDENDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDEIYDKIIYDDWMA
AIEEVKACCKNLEALVEDIDR*
4 >lcl|NP_001037758.1|Plus1complement(6093453..6093920) NW_047693 nucleosome assembly protein 1-like 5 Nap1l5 __SEG__ Chr4 {Rattus norvegicus} MADPEKQGPAESRAEDEVMEGAQGGEDAATGDSATAPAAEEPQAPAENAPKPKNDFIESLPNPVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQEL
TGEMEGCAWTLEGEDDEDDEEEEDEEEEEEEAAAGATGGPDSAEK*
5 >lcl|NP_001073849.1|Plus1complement(42972446..42973507) NW_047760 transmembrane protein 30B Tmem30b __SEG__ Chr6 {Rattus norvegicus} MTWSASARGAQQPDNTAFTQQRLPAWQPLLSAGITLPLFFCAGLAFIGLGLGLFYSSNGIQELEYDYTGNPGTGNCSVCAAKGQDRAPPPSCQCSWSFTLPELFPGPVYL
YYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFSSDGLPIAPCGAIANSLFNDSFSLWHQRQPADPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAF
KGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVGSLCIL
MGFVMLVVYIRYQDQDDDDNDDE*
6 >lcl|NP_001098082.1|Plus1complement(7423071..7424744) NW_047780 jerky homolog Jrk __SEG__ Chr7 {Rattus norvegicus} MASKQAAAKGKGEKRKRVVLTLKEKIDICSRLERGESRKALMQEYNVGMSTLYDIKAHKAQLLSFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGP
MLIEKAKDFYKQMRLTEPCVFSGGWLWRFKARHGIKKLDASSEKQVADPQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPSSTPDDGTVPRFKQGKDRLTVLM
CANATGSHRIKPLAIGKGGGPRAFRGIQHLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHPQESELVSENVFTIFLPSSVTSLLQP
TEQGIRRAFMRLFINPPVALQGFPTRHNVNDAIVNVACAWNAVPSQVFRRAWRKLWPTVPFTEGSSSGEEAECCSIKPHKTFAHILELVKEGPSCSGSRLQDSRVEERLV
SGRDMDEAPAVVAPSQTTGCAEKSEKDAGEDEETVWEQAATSFEALVRFAERQPCFSVQEVGQLQALHTVFRRQQQLRQPRVALRAVIKLEALQEHPGVCMATAHSALPC
SSTAGDN*
7 >lcl|NP_001100234.1|Plus1complement(13894214..13897273) NW_047773 microrchidia 2B Morc2b __SEG__ Chr7 {Rattus norvegicus} MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNSRDADATRIDIYAERREDLQGGFMLCFLDNGAGMDPNDAISVIQFGKSAKRTPESTQIGRYGNGLKSGSMR
IGKDFILFTKKEDTMSCLFLSRTFHEEEGIDEVIVPLPTWSAHTREPVTDNVEKFAIETELIYKYSPFHTEEEVMNQFTKISGTSGTLVIIFNLKLMDNGEPELDITSNP
KDIRMAEISQEGTKPERHSFCAYAAVLYIDPRMRIFIQGHKVQTKKLSCCLYKPRKYTFTSSRFKTRAEQEVKKADQVARLAEEKAREAESKSHTLEVHIGGDITRDSRA
MLRQVQNTAITLRREADVKKRIRDAKERALKEPKELNFVFGVNIERRDHDGMFIYNCSRLIKMYEKVGPQLEKGMACGGVVGVIDVPYLVLEPTHSKQDFADAKEYRLLL
RAMGEHLAQYWKDIAITQYGIIKFWDEFGYLSANWNRPPSEELHFKRKRAMQVPTTIQCDLCLKWRTLPFQLSAVEEGYPDNWVCSMNPDPEQDQCEAFEQTQKIPLGTL
KKVPKTQEERQKQLTEKIRQHQRKLKALKKIKPIHSQSDLKKLPWEVTTRPSSKYPAHRFQGPQPSSRAVKKSARRRLQSRHAPRPFRQLQRSSIFCTNPKSPVLADQTE
VMLLQPPETPQSPVSPVAKTLPKPTPLLQSLSPSVVPNSNNLWKVGTPKAMNAPVAEMPDPPVNPSLVKCGRKRSLEVSDKDRRKMCKRGRFAQKKEKIQANELSDSAEE
ESSADLKTAQKDKGLYVEVRVKGECYKGHVTAVEVGDNVVWWKVKFEDVPKDSTPRDCWVEKGSENVWLMKPSPEYQSTDEQQEDISREENTVVQQALALQRASISECFC
TEPDTTAPTANHKTIDLLVQILWNCLRYFMPLSFPISKKELGAMNSEELLSLPLKECFKQYEVGLQNLCHSYESCADSQAKASEESLRISQKKLQETEEKLQKLRTNIRA
LLQKAQEDINISADDELDAYIENLVSGDD*
8 >lcl|NP_001100951.1|Plus1695482..697485 NW_047556 PNMA-like 2 Pnmal2 __SEG__ Chr1 {Rattus norvegicus} MTMNLLQDWCKELEVEVHRALLITGIPERLQQADIEATLRPNLQPLGNYRLRTVRAVTKEKAQAALVEFGADFDHSAIPIHIRGENGIWKILSKDRGQDARVLRQMRRLL
LDERPMDDFREIAIPLVLEAQAQAKGLGKEAKKAGSSEGAARSGRRGRRGGKRRSRSHKLTAQKGQKRSRGGRRARSESEDSSDDSLGIVIEEIYAEDLSVDEDQRALYA
TLQAAAKELTKKWAFRGDQDEGDGPREFLALVTVTDKAKKEEIEKDLPGTESICLNIKDEKSGVPDLVALLAVRDTPAVEVETEVEDDDEEDDDDDDDEDEDEDEDDDED
DDDDGSDSESLENGEQGKEVMDSPEFVAIVAYTDPADPSAREEMLKIASVIETLGWGDKKDKKDVLPQVLSVMAKDTSGPRVKVEEAGRQVDAMVLRKAEEDGNLLECIS
TLAEAENCPKGKKSGLGLLRGWTAEGHQGGLLELVALLAAQDMVEAVREEEASRWGGGGSGGRKCDHSQGGLSEVLAFLASQENLESNEESEEDSDTESEGDSEDTDSEE
SEPGDSVSKKPRAKRARTGSKGLAPAGATAVSTGSRARKTRRGGRGRGRGVTPEKKAGSGASTEDHAGNNKKKKKKGSAGAGARVRAGEAKGQPAAVPKSTRGKKARRGP
RRAPKCR*
9 >lcl|NP_001101043.1|Plus1complement(17052134..17053546) NW_047563 tigger transposable element derived 3 Tigd3 __SEG__ Chr1 {Rattus norvegicus} MELNTKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANHERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELA
DIMGQDFVPSIGWLVRWKRRNNVGFGTRQVLVPLLPPEPPPAVSPSQAQPPLSLKDFSPEDVFGCAEVPLLYRAVPGRVFECDRLQVLLCANSRGTEKRRVFVGGLQPAP
RCFFGVNSEALPASYHPDLAIPWSEWLAQFDQDMGQQGRQVALLLASGVVEEWASPPGLHHVRLLPLSTSSTTPSLPGSVVLAFKAHYRHRLLSKLAAMQSGKEGTSRAE
ARANITVLDALHMVAAAWAKVPRQLILTSFIQEGLAPGKTPLSLDKDTEMSPVPSGLSQEEFSHFVDLEDEDPGPRVCKEETSTEDNGREEDGFESLPTKADALRALCTL
RRWLECNSTSPELFEKFYDCEVEVEQLCCL*
10 >lcl|NP_001101592.1|Plus1complement(6799800..6801374) NW_047798 jerky homolog-like Jrkl __SEG__ Chr8 {Rattus norvegicus} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEEFCNHFRDFIEQENLQPEQIYNADETGLFWKCLPSRTAVVKGKCTVPGHNSGEERITVMCCTNATGL
HKLKLCVVGKARKPRSFKSTDTFNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLKSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGV
IATMKRNYRAGLLHNNLEEGNDLKSFWKKLTLLDALYEIAMAWNFVKPVTISRAWKQILPAMEEKEGLDFDEEDISGATVATILQHTKGLENVTPESLEKWLEIDSTEPG
YEVLTDSEIIRRAQGQTDESSENDEEGIELIPEKHINHTTALQWTENLLDYLEQQGDMILPDRLVIRKLRATIRNKQKMTNPSQ*
11 >lcl|NP_001102779.1|Plus117621057..17622163 NW_047816 cyclin-dependent kinase 5, regulatory subunit 2 (p39) Cdk5r2 __SEG__ Chr9 {Rattus norvegicus} MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRD
APDGGGAAKPLAVPVPTVPASAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSL
LLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGE
AAASTGGPPSGSASTTSSSTARDSCAAGAKHWTMNLDR*
12 >lcl|NP_001119740.1|Plus18488375..8490303 NW_047780 tigger transposable element derived 5 Tigd5 __SEG__ Chr7 {Rattus norvegicus} MYPASPSAGPALHPVPHRARLPRPRCLAEPPRSPAPGPGSTARPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWF
LDQLGGEVGTQRKKMRLANEEEIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPPVAGPAPVKEEPAQPSSAG
LLLDGTPATLPHSEGGYGDEQIYNANVTGLYWRLLPEQNATPGTGDSREPGECSRRWCSDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWL
SRPLLRGWFFEEFVPGVKRYLRRSCLQQKAVLLVAHPPCPSWTTSMPAVEESEGTPRQCQPELLGSPEELQTPDGAVRVLFLSRGNSRAHIPAPLEHGVVAAFKHLYKRE
LLRLAVSCASGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPGQQPAHQVEEAAEHSRMLSDLTHLAALAYKRLAPEEVAEWLHLDDDGGLPEGCGE
EVAPAAPPSPASLPSSIGAGEEEEEEATEQGGVLVPTAGEAVWGLETALRWLESQDPREVGPLRLVQLRSLITMARRLGGIGPSAAASDDGV*
13 >lcl|NP_001119762.1|Plus12805038..2805418 NW_047657 hypothetical protein LOC366089 RGD1564319 __SEG__ Chr3 {Rattus norvegicus} MADEEELEALRRQRLAELHAKHGDPDDPAQHQAKQREAEVRNSILAQVLDQSARARLTNLAFVKPEKMKAVENYLIQMAQYGLLSGMVSEPGLIEILEKVSQQTEKKTTV
TFNRRKVMDSDEDDDY*
14 >lcl|NP_001128318.1|Plus114295085..14295915 NW_047491 HUS1 checkpoint homolog b Hus1b __SEG__ Chr17 {Rattus norvegicus} MKFRARITSKRFIELFIQVNSTIAKLTKVCVLRVCPDRLCFCPMGLLSEAKLWGEVRRNVFPHFCMEGVSQEFNEIYLELTSEHLARAVRNASNASSLKLQLTNKLRPCL
TVVVELASCPGHTRAMVHDLPVRVLPRRWWKECTEPHVRGSDVSVYLPAMKTLKNMVERMANVGSHVLVEANLKGKMNLSVETDGVTIKSYFRNLGSPPNAVLGMSQGKD
PDNMVQVRVDNRKLLRFFDGQQINPTMALCNILSNTLLHLVLVHEDISLQYFIPAS*
15 >lcl|NP_445913.1|Plus1complement(914029..914547) NW_047506 centrin 1 Cetn1 __SEG__ Chr18 {Rattus norvegicus} MASTFRKSNVASTSYKKKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKKTNLY*
16 >lcl|NP_596893.1|Plus1complement(23759358..23760968) NW_048043 nucleosome assembly protein 1-like 3 Nap1l3 __SEG__ ChrX {Rattus norvegicus} MAEADPKMVTEPAAQGVAEEAMASSACDSGDESDSNSSSSTTSCGSTGSSSSSSSSSSSSSSSSSGSSGSSSNGSHLHQKKRVPGPSRRAQRRPSGKLFMDKLPQAVRNR
VQALRNIQNECDKVDTLFLRAIHDLERKYAELNKPLYDKRFQIINAEYEPTEEECEWNSEEEFSGDEEMQDDTPNEMPPLEGEEEEEIGKENTEVKEEVKDVPEEVPEAK
VEEEEAPKETSEVKTEEKEIPKEGPEEKAEEQESSKEFPEVKVEEKTDSTDCIDIAPEEKEDLKDVTQANAEYTDQPTEDSTPRAPVREAQKRVPETRPEERVNIKRARK
GKPKKEDPPRGIPDYWLTVLKNVDKLGPMIQKCDEPILKFLSDVSLKFSNPGQPISYTFEFHFLPNPYFRNELLMKTYIIRSKPDHYDPFFAWGWEIEECKGCKIDWRRG
KDVTVTTRSRPAITGEIEVQPRVVPNASFFNFFSPPEIPLIGKLEPKEDAILDEDFEIGQILHDNVILKSIYYFTGEINDPYYHDFRDYGNRKYYK*
17 >lcl|XP_001060560.1|Plus1complement(3824624..3824863) NW_047716 CDC28 protein kinase 1b LOC681162 __SEG__ Chr5 {Rattus norvegicus} MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMFESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPLPKKPKK*
18 >lcl|XP_001070806.1|Plus1complement(7011112..7011387) NW_047711 hypothetical protein LOC689442 __SEG__ Chr5 {Rattus norvegicus} MRTLAENGREAPANGNAQNEKNGEQKADNEVDEEEEEGGEEKEKEEEEEGDSEEEGGDEDEEAEAPTGKHVAEDDEDDDLDTKKQKTDEDY*
19 >lcl|XP_002727937.1|Plus118258532..18259986 NW_047356 keratin 8-like LOC100362689 __SEG__ Chr11 {Rattus norvegicus} MSVRVTQKSYKMSTSGPRAFSSRSFTSGPGARISSSSFSRVGSSSSSFRGSLGGFGGAGVGGITAVTVNQSLLNPLKLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVR
FLEQQSKMLETKWSLLQQQQKTSRSSMDNMFESYINNLRRQLEALVQEKLKLGVELGNMQGLVEDFKNKYEDEISKHTEMENAFVLIKKDVDEAYMNKVELESHLEGLTD
EINFLRQIHEEEICELQSQISDTSGVLSMDNSRSLHMDSIIAEVRAQYEEIANRSRAEAETMYQIKYEELQTLAGKHGDDPHRSKTEISEMNPNISRLQAEMDALKGQRA
TLEAAIADAQQRGELAMKDANAKLEDLKNALQKAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGTQNMSIHTKTTSGYAGGLSSSYGGLTSPGFSYGM
SSFQPGFGSVGGSSTYSRTKAVVGKKIETRDGKLVAESSDIMSK*
20 >lcl|XP_002728174.1|Plus120282716..20284143 NW_047430 vasculin-like protein 1-like LOC100361636 __SEG__ Chr14 {Rattus norvegicus} MAQHDFVPAWLNFSTPQSAKSSTATFDKHGEHLSRGEGRFGISRRRHNSSDGFFNNGPLRTTGDSWHQPSLFRHDSVDSGVSKGAYAGTTGNLSGWHGSSRGHDGMSQRG
GGSTGNHRHWNGSFHSRKGCAFQEKTPTEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQNQPCRPIGTPSGVWENPPSAKQPSKMLVIKKISKEDPAAAFSAAFTSGSHH
ANGNKVSTMVPSVYKNLVPKPAPPPSKPNAWKANRMEHKPGSLSSSREAALTNPVSVTKPVVLAAGVVLNAPKESPSSTTPPIEISSSRLTKLTRRTTDRKSEFLKTLKD
ERNEDCSQSRDCDKLEGLRLEGSHTPEPKENGEQGCLQNGLSLPMVEEREVLSHSLEAEHRLLKAMGWQEYPENDESCLPLTEDELKEFHTRTEQLRRNGFVKNGFLQGR
SSSLFSPWRSTCIAECEDSDTGTSSSETSDDDAWK*
21 >lcl|XP_002728195.1|Plus1178552..179268 NW_047437 similar to Acidic leucine-rich nuclear phosphoprotein 32 family member A (Leucine-rich acidic nuclear protein) LOC680377 __SEG__ Chr14 {Rattus norvegicus} MEMEKRILELQNRTPSDVTELVLDNCRPTEGKIEGLVDESEDLEFLSTINIGLTSVSNLSTLNKLKKLELSENRISGTWKY*QRIRTLSV*I*VATK*KISAQ*GHRRS*
RISGVYTVYG*GDQPEYLPRCVQVPAPGHVPRWLCQGQGGP*LGC*GLRGG*Q*GR*GGGRV**VCPASGRGRG*GGRRGGRGHEWEGGG*RRSRRQGSG*CGSEEDAGE
EGNQKQKQELDDEGEEDD*
22 >lcl|XP_002728414.1|Plus116514382..16515461 NW_047469 serologically defined colon cancer antigen 3 LOC100363321 __SEG__ Chr16 {Rattus norvegicus} MSGYARRQGAPPLSRTRSLVVPDGDKLEDLEEANPFSFKEFLKTKNLSLSKEDTATSRIYPKEASRHPLGLDHNSPVSQPMGYGLEYQQPFFEDPTRASNLEEDEEDGWS
RAYLPSAVEQTHSTRATQNSSPCGTYLSFFSNASELAGPESLPPWTLSDTDSRLSPASPAGNPNVDFAAHEESLGDRHLRTLQLSYEALKDENSKLRRKLSEVQSFSETQ
TEMVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAENHVMKLKQEVNLLQAQLSNFKRENEALRSGQGASLTVVKQNTDVALQNLHVVMNSAHASIKQL
VSGAETLNLVAEILKSIDRITEVKDEADS*
23 >lcl|XP_002728508.1|Plus14583560..4583799 NW_047491 CDC28 protein kinase regulatory subunit 2 LOC100362620 __SEG__ Chr17 {Rattus norvegicus} MVHKQIYYSDKYFDEQYEYWHVMLPRELSKQVLKTHLMSEEEWRRLGVQQSLGWAHDMIHEPEPHSLLFRRPLPKEQQK*
24 >lcl|XP_002729012.1|Plus1complement(6641454..6642881) NW_047602 vasculin-like protein 1-like LOC100361476 __SEG__ Chr20 {Rattus norvegicus} MAQHDFVPAWLNFSTPQSAKSSTATFDKHGEHLSRGEGRFGISRRRHNSSDGFFNNGPLRTTGDSWHQPSLFRHDSVDSGVSKGAYAGTTGNLSGWHGSSRGHDGMSQRG
GGSTGNHRHWNGSFHSRKGYAFQEKTPTEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQNQPCRPIGTPSGVWENPPSAKQPSKMLVIKKISKEDPAAAFSAAFTSGSHH
ANGNKVSTMVPSVYKNLVPKPAPPPSKPNAWKANRMEHKPGSLSSSREAALTNPVSVTKPVVLAAGVVLNAPKESPSSTTPPIEISSSRLTKLTRRTTDRKSEFLKTLKD
ERNEDCSQSRDCDKLEGLRLEGSHTPEPKENGEQGCLQNGLSLPMVEEREVLSHSLEAEHRLLKAMGWQEYPENDESCLPLTEDELKEFHTRTEQLRRNGFVKNGFLQGR
SSSLFSPWRSTCIAECEDSDTETSSSETSDDDAWK*
25 >lcl|XP_002729065.1|Plus1complement(19850635..19850826) NW_047623 thioredoxin-like 4 LOC100363110 __SEG__ Chr2 {Rattus norvegicus} MYYILPHLHNGWQVDQAILSEEDCVVVIHFRHDWGPTCMKMDEVLYIIAETKWKIVRDCPHLV*
26 >lcl|XP_002729365.1|Plus1<6510178..6511356 NW_047693 rCG52281-like RGD1559612 __SEG__ Chr4 {Rattus norvegicus} IPKAAGKGTKLKGDETAASEFCGNFQEFVKRENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGLHKLNLCVVGKAKRPRAFKGTDLSN
LPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLNSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMDEGNDPK
LFWKNLTVLDAIYEASRAWNQIRSSTITRAWRKLFPGNEENPSVSIDEGAILAANLATVLQNTEDCEHVNIENIGQWFDSRSSGSNCQVLADLVGAADRAKAGEQKQPSR
KTRKAELNPEKHISHRAALEWTENLLDYLEQQDDMLLSDKLVLRRLRTIIRRKQRIQTKSHL*
27 >lcl|XP_002729449.1|Plus121708652..21708891 NW_047695 CDC28 protein kinase regulatory subunit 2 LOC100362643 __SEG__ Chr4 {Rattus norvegicus} MVHKQIYYSDKYFNKHYEYWHVMLPRELSKQVPKTHLMSEEEWRRLGVQKNLGWVHYMIHEPEPHILLFRQPLPKEQQK*
28 >lcl|XP_002729644.1|Plus1complement(6443856..6445928) NW_047755 crooked neck-like 1 protein LOC100360434 __SEG__ Chr6 {Rattus norvegicus} MAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDV
DYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFEHWMEWQPEEQAWHSYINFELRYKEVERARTIYERFVLVHPAVKNWIK
YARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQEAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNY
DAWFDYLRLVESDAEADTVREVYERAIANVPPIQEKRHWKRYIYLWVNYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWLYYAQFEIRQKNLPFARRALGTSIG
KCPKNKLFKGYIELELQLREFDRCRKLYEKFLEFEPENCTSWIKFAELETILGDIERARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRQLLQRTQHVKV
WISFAQFELSSVKEGSVAKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEDEFGTVSDKERVDKLMPEKVKKRRKVQADDGSDAGWEEYYDYIFPEDAANQPNLKLLAM
AKLWKKQQQEREAAEQDPDKDIDESESSSF*
29 >lcl|XP_002729799.1|Plus1734466..734654 NW_047773 thioredoxin-like 4-like LOC100360662 __SEG__ Chr7 {Rattus norvegicus} MSMLLHLHNGWQVDQAIHSEEDCVVVIHFGHDWDPTCMKIYKVLYRIAETKWKIVRDLPHPV*
30 >lcl|XP_002730112.1|Plus1complement(930868..931698) NW_047820 timeless interacting protein LOC100359731 __SEG__ Chr9 {Rattus norvegicus} MLEQEENGLFEIPDYEHVEDETFPPFPPPGSPERDPAEAEADEGSGAPVPVPPKRIVKRNIPKLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHR
LFPKLQFEDFIDRVENLGNKKEVQTCLKRIRLDLPIVHEDFVNNNDEVEETNSLDAAATGFDAFVTSSSDSKRFASEASRNLTEEQQQRIERNKQLALERRQAKLLSNSQ
SLENDVTVEESSTGENQEESNGLISADGPHDVPSASTQEEGQLEAEETQLDHPNLD*
31 >lcl|XP_227318.1|Plus12790919..2792463 NW_047626 tigger transposable element derived 4 Tigd4 __SEG__ Chr2 {Rattus norvegicus} MAEASLDAGTPPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPML
RLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGVSTDPSAVWYQNVLPYYLNDYHPKNIFNVKETGLLYRMLPTNTFAFKGETCSIGKLCKDRITLALGT
NVDGSEKLPLLIIGKNRAPHCFKGVKSLPVYYEANRTARMTAVIFEQWMQKLDEKFQAQKRRVVIFVDSLPAHPEVKNLKSIELAFFPSCLSSGFAAMNQGVIKSLKIKY
RHCLIKKFLSSVESSKEFTFSLLDAVDTLHLCWRAIAPETIVKCYEEAGFSSPRGETDTANAEEDAAALDLTAHAVGAGVEFLEGLSIEGYAALDEDLETCEDAPKDGAE
WDEESKQDVTGFYTSDEEEEDSGALEVDLPLPSTNEALTALGTLKRFLRSHDMNDELHSSLADLENFINTLSPK*
32 >lcl|XP_234352.1|Plus14860139..4860621 NW_047761 M phase phosphoprotein 6 Mphosph6 __SEG__ Chr6 {Rattus norvegicus} MASEWKTKLSTNLLLMKFMQRGLDSENQKQLEEEERKTIRNEHWYLDLPELKEKESFIIEDQSFSLCEDLLYGRMSFRGFNPEVEKFMLQMNSRNRAAAAEEETVEADVS
EKEMARRYESLVGTIGKMFSKKRDRANDKEDENGNIKAIKTKKIFLKPQD*
33 >lcl|XP_235062.1|Plus19388993..9389427 NW_047774 rCG38845-like Ndufa13 __SEG__ Chr7 {Rattus norvegicus} MASKVKQDMPPPRGYGPIDYKRNLPRRRGLSGYSMFALGIGALIFGYWRIMRWNRERRRLLIEDLEARIALMPLLQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESM
FHTTRWVPPLIGELYGLRTKEEMENANFGFTGYT*
34 >lcl|XP_342522.1|Plus1complement(9061815..9063626) NW_047658 centromere protein B Cenpb __SEG__ Chr3 {Rattus norvegicus} MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEE
LGMDDFTASNGWLDRFRRRHGVVACSGVTRSRARSSAPRAPAAPAGPATVPSEGSGGSTPSWRTREEQPPSVAEGYASQDVFSATETSLWYDFLSDQASGLWGGDGPARQ
ATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQGGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLERGVV
QQVKGHYRQAMLLKAMAALEGQDPSGLQLGLVEALHFVAAAWQAVEPSDIATCFREAGFGGGLNATITTSFKSEGEEEEEEEEEEEEEEEEGEGEEEEEEEEEGEEEEGG
EGEEVGEEEEEVEEEGEVDDSDEEEEEESSSEGLEAEDWAQGVVEASGGFGGYSVQEEAQCPTLHFLEGGEDSDSDSDEEEEDEEEDEEDEEDEDDDEDGDEVPVPSFGE
AMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS*
35 >lcl|XP_576332.1|Plus1complement(2883556..2884074) NW_047784 tumor protein, translationally-controlled 1 RGD1565798 __SEG__ Chr7 {Rattus norvegicus} MIIYRDLISHDELFSNIYKIREIADRPCLEVEGKMVSRTEGAIDDSLIGGNAPAEGPEGGRTESTVVTGVDIVLNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPER
VKPFMTGAAEKIKRILANFNNYQFFIGENMNPDGMVALLEYPEDGVTPFMIFFKDGLEMEKC*
36 >lcl|XP_580067.1|Plus134094..34513 NW_047712 hypothetical protein RGD1560723 __SEG__ Chr5 {Rattus norvegicus} MSDAAVDSSSEITTKDLKEKEAGEEAENGRRAPANGNARNEENGEQEADNEVDEEEEEGGEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQKTDEDDR
TANGKANLTHRDLFTVHFLSQNLNGVTIA*