SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro D    

ID / Description / Sequence
1 >lcl|NP_001009036.1|Plus1complement(2669711..2670421) NW_003458524 baculoviral IAP repeat-containing protein 8 BIRC8 __SEG__ Chr19 {Pan troglodytes} MTGYEARLITFGTWMYFVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRINDTIF
PNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENESNQTSLQREISPEEPLRRLQDEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRC
PMCSAVIDFKQRVFMS*
2 >lcl|XP_001136245.1|Plus1complement(3300553..3302073) NW_003459077 nucleosome assembly protein 1-like 3 isoform 2 NAP1L3 __SEG__ ChrX {Pan troglodytes} MAEADFKMVSEPVARGVAEEEMASSTSDSGEESDSSSSSSSTSDSSSSSSTSGSSSGSGSSSSSSGSTSSRSRLYRKKRVPEPSGRARRAPLGTNFVDRLPQAVRNRVQA
LRNIQDECDKVDTLFLKAIHDLERKYAELNKPLYDRRFQIINAEYEPTEEECEWNSEDEEFSSDEEVQDNTPSEMPPLEGEEEENPKENPEVKAEEKEVPKEIPEVKDEE
KEVPKEIPEVKAEEKADSKDCMEATPEVKEDPKEVPQVKADDKEQPKATEAKARAAVREAHKRVPEERLQDSVDLKRARKGKPKREDPKGIPDYWLIVLKNVDKLGPMIQ
KYDEPILKFLSDVSLKFSKPGQPVSYTFEFHFLPNPYFRNEVLVKTYIIKSKPDHNDPFFSWGWEIEDCKGCKIDWRRGKDVTVTTTQSRTTATGEIEIQPRVVPNASFF
NFFSPPEIPMIGKLEPREDAILDEDFEIGQILHDNVILKSIYYYTGEVNGTYYQFGKHYGNKKYRK*
3 >lcl|XP_001140553.2|Plus1complement(175..537) NW_003459042 putative nucleosome assembly protein 1-like 6-like LOC739275 __SEG__ ChrX {Pan troglodytes} MMEGLGKHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVERKFATIYGPLLEKRRQITNALYEPTKESVRGEVH
VEDYEYNEWP*
4 >lcl|XP_001141012.1|Plus1complement(73451..74833) NW_003459044 nucleosome assembly protein 1-like 2 isoform 3 NAP1L2 __SEG__ ChrX {Pan troglodytes} MAESENHKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSGEDGKKGGDTDEDSEADRPKGLIGYVLDTDFVESLPVKVKY
RVLALKKLQTRAANLESKFLREFHDIERKFAEMYQPLLEKRRQIINAIYEPTEEECEYKSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDYAVEEEEEEEE
EEDIEATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLAYYDPHPYRGTAIEYSTG
CEIDWNEGKNVTLKTIKKKQKHRIWGTIRTVTEDFPKDSFFNFFSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWMAA
IEEVKACCKNLEALVEDIDR*
5 >lcl|XP_001146644.1|Plus1complement(3228661..3229179) NW_003456608 translationally-controlled tumor protein-like isoform 7 LOC741416 __SEG__ Chr1 {Pan troglodytes} MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEGYKKYIKDYMKSIKGKLEEQRPER
VKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC*
6 >lcl|XP_001158862.1|Plus111807495..11808946 NW_003457226 keratin, type II cytoskeletal 8 isoform 4 KRT8 __SEG__ Chr8 {Pan troglodytes} MSIRVTQKSYKVSTSGPRAFSSRSYMSGPCARISSSSFSRVGSSTFRGGLGGGCGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAMHTQEKEQIKTLNNKFASFIDKVW
FLEQQNKMLETKWSLLQQQKTAQSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKHTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDE
INFLRQLYEKEIREPQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANCSWAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNQNISQLQAEIEGLKGQRAS
LEATIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLHEYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYGLG
SSFGSGAGSSSFSRTSSSRAVVVKKIETCDGKLVSESSDILPK*
7 >lcl|XP_001158954.1|Plus1complement(484003..484839) NW_003457099 checkpoint protein HUS1B HUS1B __SEG__ Chr6 {Pan troglodytes} MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVCPDSLCFGPAGSGGLREARLWCEVRQGAFQQFRMEGVSEDLNELHLELTAEHLSRAARSAAGASSLKLQLTHKRRP
CLTVAVELVSSLGRARSVVHDLPVRVLPRGVWRDCLPPSLRAADASICLPRWRTLRSIVERMANVGDHVLVEANLSGRMTLSIETEVVSIHSYFKNLGNPPKSAVGVPQH
RDLESMVQVRVDNRKLLQFLEGQQIHPTTAVCNIWDNALLQLVLVQEDVSLQYFIPAL*
8 >lcl|XP_001159222.1|Plus12140691..2143087 NW_003458251 serine/threonine-protein kinase haspin GSG2 __SEG__ Chr17 {Pan troglodytes} MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVGRQRRRPGGRVPKDRPSVTVTPKRWKLRARPSLT
VTPRRLGLRARPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSPTPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCS
QEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTSKRRATGQDSSQERGLQEAVRREHQEASVPKGRIVSRGIDR
LERTRSSRKSKHQEAAETSLLHSHRFKKGQKLGKDSFPTQDLTPLQNACFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSECSNRPVMNRTSGAPSSWHSSS
MYLLSPSNTLSISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVC
NRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMQTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGVQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQI
KRKIQEFHRTMLNFSSATDLLCQHSLFK*
9 >lcl|XP_001160970.1|Plus1complement(8839031..8839579) NW_003456973 nucleosome assembly protein 1-like 5 NAP1L5 __SEG__ Chr4 {Pan troglodytes} MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGEMAEEPQTPAENAPKPKNDFIENLPNLVKRPIMALKKLQKRCDKIEAKFDKEFQALEKKYN
DIYKPLLAKIQELTGEMEGCAWTLEGEEEEEEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK*
10 >lcl|XP_003310016.1|Plus1<18566366..18566695 NW_003456887 prothymosin alpha-like LOC100615378 __SEG__ Chr3 {Pan troglodytes} SDAAVDRSSEIATKDLKEKKEVVEEAENGKDAPANGNANEENGEQEADNEVDEKVEEGGEEEEKEEEGDGEEEDGDEDEEAESATGKQAAEDDEDDDVNTRKQKTDEDD*
11 >lcl|XP_003310810.1|Plus1complement(539796..540185) NW_003457048 striatin-like LOC100613843 __SEG__ Chr5 {Pan troglodytes} MAVASTKSRWETDEVQAQSAAKTLSCKDIVAGDMSKKSLWEQKGGSKTSSTIKAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQKRAKCHKLKYGTQLNQGDMKPPSY
DSDEGDETEVQPQQNSQLM*
12 >lcl|XP_003310822.1|Plus1complement(3780734..3781252) NW_003457057 translationally-controlled tumor protein-like TPT1 __SEG__ Chr5 {Pan troglodytes} MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPER
VKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC*
13 >lcl|XP_003311984.1|Plus1complement(36115..37821) NW_003457271 jerky protein homolog JRK __SEG__ Chr8 {Pan troglodytes} MASKPAAGKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETSLFWRCLPNPTPEGGAVPGPKQGKDRLTVLM
CANATGSHRLKPLAIGKCSGPRAFKGIQHLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAVLLLDSSRAHAQEAELVSSNVFTIFLPASVASLVQP
MEQGIRRDFMRNFINPPAPLQGPHARYNMNDAIFSVACAWNAVPSHVFRRAWRKLWPSVAFAEGSSSEEEVEAECFPVKPHNKSFAHILELVKEGSSCPGQLRQRQAASW
GVAGKEAEGGRPPTATSPAEVVWSSEKTPKADQDGGGDPGEGEEVAWEQAAVAFDAVLCFAERQPCFSTQEVGQLRALRAVFRSQQQVRRRRGALGAVVKVEALQEGPGG
CGATAQSPLPCSSTAGDN*
14 >lcl|XP_003313037.1|Plus11072004..1072810 NW_003457670 acidic leucine-rich nuclear phosphoprotein 32 family member E ANP32E __SEG__ Chr11 {Pan troglodytes} MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQ
NLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSY
LMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD*
15 >lcl|XP_003313235.1|Plus1292855..293373 NW_003457694 translationally-controlled tumor protein-like LOC466689 __SEG__ Chr11 {Pan troglodytes} MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPER
VKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC*
16 >lcl|XP_003313278.1|Plus112412284..12412523 NW_003457698 cyclin-dependent kinases regulatory subunit 1-like LOC749038 __SEG__ Chr11 {Pan troglodytes} MSHKQIYYSDKYDDEEFEYRHVVLPKDIAKLVRKTHLMSESEWRNLGVQQSQGWVYYMIHEPEPHILLFRCPLPKKPKK*
17 >lcl|XP_003314561.1|Plus1819410..819649 NW_003457860 cyclin-dependent kinases regulatory subunit 1 CKS1B __SEG__ Chr14 {Pan troglodytes} MSHKQIHYSDRYDDDEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGIQQSQGWVHYMIHESEPHILLFRRPPPKKPKK*
18 >lcl|XP_003317450.1|Plus1511287..511526 NW_003458814 cyclin-dependent kinases regulatory subunit 1-like LOC735669 __SEG__ ChrX {Pan troglodytes} MLHKQIYYSDKYDDEEFEYQHVILPKDKAKLVPKTHLMSESEWRNLGIQQSQGWVHYMIHEPEPHILLFWRPLPKKPKK*
19 >lcl|XP_003317716.1|Plus1complement(918753..920144) NW_003459190 DDB1- and CUL4-associated factor 12-like protein 2-like LOC100613674 __SEG__ ChrX {Pan troglodytes} MAQQQTGSRKRKAPAVEAGAGSSSSQGLAAADGEGPLLPKKQKRPATRRRLVHYLKGREVGARGPAGLQGFEGELRGYAVQRLPELLTERQLDLGTLNKVFASQWLNARQ
VVCGTKCNTLFVVDVQSGHITRIPLMRDKEAGLAQAQQGCGIHAIELNPSKTLLATGGENPNSLAIYQLPTLDPLCLGDRHGHKDWIFAVAWLSDTVAVSGSRDGTVALW
RMDPDMFNGSIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRALAFSGKNQELGAVSLDGYFHLWKARSTLSRLLSIRLPYCRENVCLTYCDELSLYAVGSQSHVS
FLDPRQRQQNIRPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQKFLEERASSSLDSMPGPAGRKLKLACGRGWLNQDDVWVNYFGGMEEFPNALYTHCYNWPE
MKLFVAGGPLPSGLHGNYAGLWS*
20 >lcl|XP_003318170.1|Plus1complement(<4..1275) NW_003476879 major centromere autoantigen B-like LOC100613707 __SEG__ Chr20 {Pan troglodytes} MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEE
LGMDDFTASNGWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRALEEQPPSVAEGYASQDVFSATETSLWYDFLPDQAAGLCGGDGRPRQ
ATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLERGVV
QQVKGHYRQAMLLKAMAALEGQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEEGEGE
21 >lcl|XP_516099.2|Plus1891163..892266 NW_003456853 cyclin-dependent kinase 5 activator 2 CDK5R2 __SEG__ Chr2B {Pan troglodytes} MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRD
PPDGGGTAKPLAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQAAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSL
LLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGE
AAASGGGPPSGGAPAASSAARDSCAAGTKHWTMNLDR*
22 >lcl|XP_517520.1|Plus1complement(1490211..1490915) NW_003456990 acidic leucine-rich nuclear phosphoprotein 32 family member C isoform 4 ANP32C __SEG__ Chr4 {Pan troglodytes} MEMGRRIHSELRNRAPSDVKELALDKSRSNEGKLEALTEEFEELEFLSTINGGLTSISDLTKLKLRKLELRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKQLEN
LKSLDLFNCKVTNLNDFRENVFKLLLQLTYLDSCYWDHKEAPDSDIKGYVEGLDDEEEGEDEEEYDEDAQVVEDEEGEDEEEEGEEEDVSGGEEEDEEGYNDGEVDGEED
EEELGEEERGQKRK*
23 >lcl|XP_523881.1|Plus1complement(3003824..3004342) NW_003458381 centrin-1 CETN1 __SEG__ Chr18 {Pan troglodytes} MASSFKKPSAASTSQKRKVVPKPELTEDQKQEVREAFDLFDVDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEGTGKISFNDFLAVMTQKMSEKDTKEEILKAF
RLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY*