SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus D    

ID / Description / Sequence
1 >lcl|NP_001028353.1|Plus1complement(75466..77037) NT_166314 jerky protein homolog-like Jrkl __SEG__ Chr9 {Mus musculus} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGL
HKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGV
IAAMKRNYRAGLLHNNLEEGNDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKQILPAIEEKEGLDFDEDISGATVATILQHTKGLENVTPENLEKWLEIDSTEPGY
EVLTDSEIIRRAQGQTDESSENDEERIELIPEKHINHTTALQWTENLLDYLEQQGDMILPDRLVIRKLRATIRNKQKMTNPGQ*
2 >lcl|NP_001028979.1|Plus1complement(15231266..15231967) NT_039706 hypothetical protein LOC619303 4930567H17Rik __SEG__ ChrX {Mus musculus} MFNAAQSRIDRMAMEDGITPEQAFTNQTTAAGNPSMGPLRPHKRSNIPVSAPAESPTQATHKPCKLVSSYNDTEYPSATIDMDVPGYERTSHSWYLRYGRTLSSYDPCRY
ILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEEDEEMEEEDEDEEEEMEEDEEEEDKEGEDEEEEYYTMEEEEYEEYEEYEEECEDDDDHYTENNCIICALFK
FIRMLFSPGRGTA*
3 >lcl|NP_001033011.1|Plus112528773..12529063 NT_078575 predicted gene 6531 Gm6531 __SEG__ Chr8 {Mus musculus} MPACCWELSGGQRRGAIMSHKQIYYSDKYDDEEFEYRHVMLPKDIDKLVPKTHLMSESEWRKLGVQQSQGWVHYMIHEPELHILLFQWPLPKKPKK*
4 >lcl|NP_001074614.1|Plus111473106..11474683 NT_039353 tigger transposable element-derived protein 2 Tigd2 __SEG__ Chr6 {Mus musculus} MLGKRKRVVLTIKDKLDIIKKLEEGNSFKKLSVLYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSMKSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQARFFF
DALGMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGS
HKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLSSDDGRIIVKYLPPNVTSLIQPMSQGV
LTTVKRYYRAGLIQKYMDEGNDPKTFWKNLTVLDAIYEASRAWNQIRSNTITRAWKKLFPGNEENPSVSIDEGAILAANLATVLQNTEDCEHVNIENIEQWFDSRSSGSN
CQVLADIVGAADRAKVTEQKPSRKTRKAELNPEKHISHKAALEWTENLLDYLEQQDDMLLSDKLVLRRLRTIIRRKQRIQNKSHL*
5 >lcl|NP_001093106.1|Plus114530442..14532427 NT_039413 PNMA-like protein 2 Pnmal2 __SEG__ Chr7 {Mus musculus} MTMNLLQDWCKELEVEVHRALLITGIPERLQQADIEATLSPNLQPLGNYRLRTVRAVTKEKSQAALVEFGADFDHSAIPIHIRGENGIWKILSKDRGQDARVLRQMRRLL
LDERPMDDFREIAIPLVLEAQAQAKGLGKEAKKAGSSEGAARSGRRGRRGGKRRSRSHKLTAQKGQKRSRGGRRARSESEDSSDDSLGIVIEEIYAEDLSVDEDQRALYA
TLQAAAKELTKKWAFRGDQEEGDGPREFLALVTVTDKAKKEEIEKDLPGTESICLNIKDEKSGVPDLVALLAVRDTPAVEVETEVDDDDEDDEDEDDEDDDEDEDDDEDD
SDSESLENGEHGKEVMDSPEFVAIVAYTDPADPSAREEMLKIASVIETLGWGDKKDKKDVLPQVLSVMAKDTSGPRVKVEEAGRQVDAMVLRKAEEDGNLLECISTLAEA
ENCPKGKKSGLGLLRGWTAEGHQGGLLELVALLAAQDMVEAVREEEASRWGSGGSGGRKCDHSQGGLSEVLAFLASQENLESNEESDEDSDTESEGDSEDTDSEESEPGD
SVSKKPRAKRARTGSKGLPPAGATAVSTASRARKARRGGRGRGRAVTPEKKTGSGVSTEDHAGNNNKKKKGSAGAGARARAGEAKGQPAAVPKSTRGKKARRGPRRAPKC
R*
6 >lcl|NP_031619.3|Plus1complement(6618899..6619417) NT_039674 centrin-1 Cetn1 __SEG__ Chr18 {Mus musculus} MASTFRKSNVASTSYKRKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKKTNLY*
7 >lcl|NP_031708.2|Plus1complement(72045115..72046914) NT_039207 major centromere autoantigen B Cenpb __SEG__ Chr2 {Mus musculus} MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEE
LGMDDFTASNGWLDRFRRRHGVVACSGVTRSRARSSAPRAPAAPAGPATVPSEGSGGSTPGWHTREEQPPSVAEGYASQDVFSATETSLWYDFLSDQASGLWGGDGPARQ
ATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQGGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLERGVV
QQVKGHYRQAMLLKAMAALEGQDPSGLQLGLVEALHFVAAAWQAVEPSDIATCFREAGFGGGLNATITTSFKSEGEEEEEEEEEEEEEEEEEGEGEEEEEEEEEGEEEGG
EGEEEGEEEVEEEGEVDDSDEEEEESSSEGLEAEDWAQGVVEASGGFGGYSVQEEAQFPTLHFLEGGEDSDSDSDEEEDDEEEDEEDEDEEDDEDGDEVPVPSFGEAMAY
FAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS*
8 >lcl|NP_032441.4|Plus1complement(35822195..35823868) NT_039621 jerky protein Jrk __SEG__ Chr15 {Mus musculus} MASKQAAAKGKGEKRKRVVLTLKEKIDICTRLERGESRKALMQEYNVGMSTLYDIKAHKAQLLRFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGP
MLIEKAKDFYKQMRLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPNSAPDDGTVPHFKQGKDRLTVLM
CANATGSHRIKPLAIGKGGGPRAFRGIQHLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHSQESELVSENVFTIFLPSSVTSLLQP
TEQGIRRAFMRLFINPPVAFQGFPTRHNINDAIVNVARAWNAVPSQVFQRAWRKLWPTVTFTEGSSSEEEAECCAIKPHKTFAHILGLVKEGPTCSGSRLQDSRVEERVV
AGRDIDEAPAIVAPSQATRCTKKSEKDTGETEEAAWEQAATSFEALVRFAERQPCFSVQEMGQLQALHTVFRRQQQLRQPRVALRAVIKLEALQEHPGVCVATTHPTLPC
SSTAGDN*
9 >lcl|NP_032697.2|Plus1complement(47964374..47965756) NT_039706 nucleosome assembly protein 1-like 2 Nap1l2 __SEG__ ChrX {Mus musculus} MAESVDHKELSESNQEELGSQVMAEGPGESQDRSEGVSIEPGDGGQHGEETVAAGVGEEGKGEEAAAGSGEDAGKCGGTDEDSDSDRPKGLIGYLLDTDFVESLPVKVKC
RVLALKKLQTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEYKSDCEDYFEEEMDEEEETNGNEDGMVHEYVDEDDGYEDCYYDYDDEEEEEEE
DDSAGATGGEEVNEEDPKGIPDFWLTVLKNVEALTPMIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLACYDPHPYRGTAIEYATG
CDIDWNEGKNVTLRTIKKKQRHRVWGTVRTVTEDFPKDSFFNFFSPHGISLNGGDENDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDEIYDKIIYDDWMAA
IEEVKACCKNLEALVEDIDR*
10 >lcl|NP_033177.3|Plus1complement(283005..284258) NT_078458 P-selectin glycoprotein ligand 1 Selplg __SEG__ Chr5 {Mus musculus} MSPSFLVLLTILGPGNSLQLQDPWGHETKEAPGPVHLRERRQVVGDDDFEDPDYTYNTDPPELLKNVTNTVAAHPELPTTVVMLERDSTSAGTSERATEKIATTDPTAPG
TGGTAVGMLSTDSATQWSLTSVETVQPASTEVETSQPAPMEAETSQPAPMEAETSQPAPMEAETSQPAPMEADTSQPAPMEADTSKPAPTEAETSKPAPTEAETSQPAPN
EAETSKPAPTEAETSKPAPTEAETTQLPRIQAVKTLFTTSAATEVPSTEPTTMETASTESNESTIFLGPSVTHLPDSGLKKGLIVTPGNSPAPTLPGSSDLIPVKQCLLI
ILILASLATIFLVCTVVLAVRLSRKTHMYPVRNYSPTEMICISSLLPEGGDGAPVTANGGLPKVQDLKTEPSGDRDGDDLTLHSFLP*
11 >lcl|NP_034001.1|Plus145795889..45796812 NT_096135 cyclin-dependent kinase 5 activator 1 Cdk5r1 __SEG__ Chr11 {Mus musculus} MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPP
ASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDH
ELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR*
12 >lcl|NP_034002.2|Plus152428323..52429432 NT_039170 cyclin-dependent kinase 5 activator 2 precursor Cdk5r2 __SEG__ Chr1 {Mus musculus} MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRD
GPDGGGTAKPLAVPVPTVPTTAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSL
LLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGE
AAASTGGPPSGSSASTTSSSSARDSCATGAKHWTMNLDR*
13 >lcl|NP_034483.1|Plus1complement(38454377..38456641) NT_096135 serine/threonine-protein kinase haspin Gsg2 __SEG__ Chr11 {Mus musculus} MAQAHPRSGTRLFRTYAARGVRGSQRQPGGLAEQWFQPPNLKRAFSSSLSDSNESPAVASDDPDDPDFPGSLVGQRRRRPRGSGSRNQRTLTNTPRVQRLRPRLPQKCST
PCSRLRPPPFPNCSPGCLGSDHSVCIQSRDSNELGTSASLFSSPASPGAPDPLYADSAVPGSFHLPAASLSEPSVPCPQVAATGDRYTGRALRAEASFRSSLFSLVNSGA
TEENKFGTDGENVKESCCERRQQMGNRLTDPDLTSPGKRKAACKKVVSQGVDQRDYEESSACKDLRVPGEISRPKRTGPLRKRKQQEATGTPPRHYHQSKKKRKASVSLW
NLNTSQRDSWTKTRASFGFHKKKIITSVIEVCSSVASSSSRSLLSECSTPPIKNRAHLTVSSRCSSVYLLSPLKTLHVTDQRPSYAEKVYGECNQEGPIPFSDCLSTEKL
ERCEKIGEGVFGEVFQIINDQAPVALKIIAIEGLDLVNGSHQKTFEEILPEIIISKELSLLSSEAYNRTEGFIGLNSVHCVQGLYPPLLLKAWDHYNTTKRSANDRPDFF
QEDQLFIILEFEFGGVDLERMKTKLSSVATAKSILHQITASLAVAEASLHFEHRDLHWGNVLLKKTNLKELRYTLNGKTSTIPTHGLQVNIIDYTLSRLERDGIVVFCDI
SAEEDLFTGEGDYQFEIYRLMRKENKNCWGEYHPYNNVLWLHYLTDKILNKMKFKTKCQSAAMKQIRKNLQHFHRTVLSFSSATDLLCQHSLFR*
14 >lcl|NP_067407.1|Plus1complement(11169453..11169923) NT_039353 nucleosome assembly protein 1-like 5 Nap1l5 __SEG__ Chr6 {Mus musculus} MADPEKQGPAESRAEDEVMEGAQGGEDAATGDSAAAPAAEEPQAPAENAPKPKKDFMESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQEL
TGEMEGCAWTLEGEDDEDDEEEDDEEEEEEEEAAAGATGGPNFAKK*
15 >lcl|NP_620081.1|Plus1complement(11039087..11040721) NT_039713 nucleosome assembly protein 1-like 3 Nap1l3 __SEG__ ChrX {Mus musculus} MAEADPKMVTEPGAHGVAEEAMASTACDSGDESDSNSSSSTNSCSSSGSSSSGSSSSSSSSSSSSSSSSSSSSGSSGSSSNGSHLNRKKRVPEPSRRAQRRPSGKLFLDK
LPQAVRNRVQALRNIQNECDKVDTLFLRAIHDLERKYAELNKPLYDKRFQIINAEYEPTEEECEWNSEEEFSGDEEMQDDTPNEMPPLEGEEEEESCNEKAEVKEEGTHV
PEEVPEAKVEEEEAPKETPEVKTEEKDIPKEGAEEKAEEQESSKEIPEVKGEEKADSTDCIDIAPEEKEDVKEVTQANTENKDQPTEEFTPRAPAREAQKRVPETRPEEG
VNIKRARKGKPKKEDPKGIPDYWLTVLKNVDKLGPMIQKCDEPILKFLSDVSLKFSNPGQPIGYTFEFHFLPNPYFRNELLMKTYIIRSKPDHYDPFFAWGWEIEECKGC
KIDWRRGKDVTVTTTRSRPGITGEIEVQPRVVPNASFFNFFSPPEIPLIGKLEPREDAILDEDFEIGQILHDNVILKSIYYFTGEINDPYYHDFRDYGNRKYYK*
16 >lcl|NP_694712.1|Plus1complement(19865372..19866202) NT_039578 checkpoint protein HUS1B Hus1b __SEG__ Chr13 {Mus musculus} MRFRARITSKRFIELFIQVSSTVAKLAKVCVLRVCPDRLYFCPMGLLGEAQLWGEMRRDVFHHFCMEGASQEFNEICLELMSEHLARAVKNAGNASSLKLQLTNKQRPCL
TLVVELASCPGHTRAVVHDLPVRVLPRRRWKDCTEPHVRGSDVSVYLPALKTLKNMVERMANVGSHVLVEANLNGRMNLTVETDRVTIKSYFKNLGNPPNAVLCMSQGRD
PETMVQVRVDNRKLLQCFDGHQINPTMALCNILSNTLLHLVLVHEDISLQYFIPAS*
17 >lcl|NP_775610.1|Plus1complement(14356772..14358175) NT_096135 interferon inducible GTPase 9930111J21Rik2 __SEG__ Chr11 {Mus musculus} MGQTSSSTPPPKEDPDLTSSFGTNLQNFKMKTKILSQELIAFIESSLEDGNLQETVSAISSALGGIEKAPLNIAVMGETGAGKSSLINALQGVGDDEEGAAASTGVVHTT
TERTPYTYTKFPSVTLWDLPGIGSTAFQPHDYLKKIEFEEYDFFIIVSSGRFKHNDAELAKAIVQMNRSFYFVRTHTDLDLMVVKRSNPRRFNRENTLKQIRHTISSMLK
EVTHQEPPVFLVSNFDVSDFDFPKLESTLLSQLPAYKHHMFMLTLPIVTDSTIDRKRDMLKQKVWKESTMPRAWATIPSLGLTQKDMEMLQQTLNDYRSSFGLDEASLEN
IAEDLNVTLEELKANIKSPHLLSDEPDTSLTEKLLKYIGNPYFSKVFHLQNYFIDTVASDVKIILSKEELFTEQVSSFNSKASLYREESVGKVFPVGPGSTFLFHFIEMF
QSDSDELCHVHVLLLLTSGGLSSETVT*
18 >lcl|NP_808387.2|Plus1complement(19466459..19469527) NT_039649 MORC family CW-type zinc finger protein 2B Morc2b __SEG__ Chr17 {Mus musculus} MAFTNYSTLNRAQLTFDYLHTNSTTHAFLFGALAELIDNARDADATRIDIYAEKREDLQGGFMLCFLDNGVGMDPNDVINVIQFGKSAKRTPESTQIGRYGNGLKSGSMR
IGKDFILFTKKENTMSCLFLSRTFHEEEGIDEVIVPLPTWNSQTREPVTDNMEKFAIETELIYKYSPFHTEEEVMTQFTKISGTSGTLVVIFNLKLTDNGEPELDVTSNP
KDIRMAEISQEGVKPERHSFCAYAAVLYIDPRMRIFIHGHKVQTKKLCCCLYKPRKYTFTSHRFKTRAEQEVKKADQVAQLAEEKAREAESKARTLEIHMGGDITRDSRV
MLRQVQNTAITLRREADVKKRIRDAKQQALKEPKELTFVFGVNIEHRDHDGMFIYNCSRLIKMYEKVGPQLEKGMVCGGVVGVIDVPYLVLEPTHNKQDFADAKEYRHLL
RAMGEHLAQYWKDIEIAQHGIIKFWDEFGYLSANWNRPPSDELHFKRKRAMQVPTTIQCDLCLKWRTLPFQLSAVEEGYPINWVCSMNPDPEQDQCEAFELKQKIPLGIL
KKAPKTQEERQKQLTEKIQQEQRKLKALKKIKPIHSQSDLKKLPLEVTSRPFSKYPAHIFQGPQSSFHVVKTNARRRPQSRHAPFRQLQRSSIICTNPKPPFLVDKTEAV
LLQPPETPQKSVSLLVKTIPQPPPLVQSLSPSVVPKSNNPWKVETPQIMNTPVAEMPYVPVNPSLVICDHKRSPEVSDEIEDEDRRKRMCKRGRFTVKKEKIQASELSDS
SGEENPVDLKTAQKDKGLYVEVRMMGECYKGHVTAVEVGDNVVWWKVKFEDMPKDSTPRDCWVEKGSENVWLVKPSPEYQSTDEQQEDRKGEEDTVVQQALALQQTSTSE
CFCTEPDTTASTANHKTIDLLVQILWNCLHYFMPLSFPISKKELGAMNSEELLSLPLKECFKQYEVGLQNLCRSYQRCADSQAKVSEESLRISQKKLQETEEKLQKLRTN
IQTLLQMAQQGINIRADDELDAYIEDLVSSDD*
19 >lcl|NP_848761.2|Plus137026225..37028153 NT_039621 tigger transposable element derived 5 Tigd5 __SEG__ Chr15 {Mus musculus} MYPASPPAGPALHPVPHRARLPQPRCLAEPPRSPAPGPGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRW
FLDQLGGEVGTQRKKMRLANEEEIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAESPVAGPAPVKEEPAQSPGA
VLVPDGAPATLPHSEGGYGDEQIYNANVTGLYWRLLPEQASTPGTGDSKEPGGCSRRWRSDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAW
LSRPLLRGWFFEEFVPGVKRYLRRSCLQQKAVLLVAHPPCPSWATSMPPLEESEETPRQCQPELLGSPEELQTPDGAVRVLFLSKGTSRAHIPAPLEHGVVAAFKHLYKR
ELLRLAVSCASGSPLDFMRSFVLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPGQQPAHQVEETAEHSRVLSDLTHLAALAYKRLAPEEVAQWLHLDDDGGLPEGCR
EEVAPAAPPSPASLPSSIGAGEEEEEATEQGGVLVPTAGEAVWGLETALRWLESQDPREVGPLRLVQLRSLITMARRLGGIGPSAVTSDDGV*
20 >lcl|NP_848830.1|Plus1complement(31971479..31972540) NT_039551 cell cycle control protein 50B Tmem30b __SEG__ Chr12 {Mus musculus} MTWSATARGAHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLAFIGLGLGLFYSSNGIKELEYDYTGNPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELFPGPVYL
YYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFRSDGLPIAPCGAIANSLFNDSFSLWHQRQPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAF
RGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVGSLCIV
MGFVMLVVYIRYQDQDDDDNDDE*
21 >lcl|NP_898997.2|Plus1complement(27910574..27912130) NT_039606 homeobox and leucine zipper protein Homez Homez __SEG__ Chr14 {Mus musculus} MSPNKDASSLNSSAAGLVCLPPVSEELQLVWTQAIQTSELDGNEHLLQAFSYFPYPSLADIALLCLRHGLQMEKVKTWFMAQRLRCGISWSSEEIEETRARVVYHRDQLL
FKSLLSFTQQSVRPPQERPPVLRPEQVALGLSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQSDCQDLQISGLSKEQAGRGPDQSCGKTASW
NHFTAVHQPDKPASVSLLDNSCKEESEPSGIPPSSSTSSPSFQALANGTTATPKPLQPLGCISQSLSPSKKALSPQVEPLWPQRLWNNSEPNSAGPTEYLSPDMQHQRKT
KRKTKEQLAILKSFFLQCQWARREDYHKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNAVLGTPSFQDPAIPTPSTRSLKEWAKTPPLPAPPPPPDIRPLEKYWAA
HQQLQEADILKLSQASRLSTQQVLDWFDSRLPKPAEVVVCLDEEDEEDEEDELPEDGEEEEEEEEDDDDGDDDVIIWD*
22 >lcl|NP_932106.1|Plus1complement(44069290..44070042) NT_096135 cyclin-related protein FAM58A Fam58b __SEG__ Chr11 {Mus musculus} MEAVRPDSCESGPAAPRAEERPAPEARVHFRVTRFIMEAGVKLGMQSIPIATACTIYHKFFCEINLDAYDLYLVAMSSIYLAGKVEEQHLRTRDIINVSHRYFNPGSEPL
ELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLISLKNWLNRYSWQRTPISVTAWALLRDSYHGGLCLRFQAQHLAVAVLYLALQVYGVEVPAEGEAEKPWW
QVFSDDLTKPIIDNIVSDLIQIYTMDTEIP*
23 >lcl|NP_941036.1|Plus1complement(2891688..2893100) NT_082868 tigger transposable element-derived protein 3 Tigd3 __SEG__ Chr19 {Mus musculus} MELNTKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANHERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELA
DIMGQDFVPSIGWLVRWKRRNNVGFGTRQVLVPLFPPEAPPAVLPSQAQPPLSLKDFSPEDVFGCAEVPLLYRAVPGRVFECDRLQVLLCANSRGTEKRRVFVGGLQAAP
RCFFGVSSEALPTSYHPDLAIPWSEWLAQFDQDMGQQGRQVALLLASGVVEEWASLPGLHHVRLLPLSASSTTPSLPGSVILAFKAHYRHRLLSKLAAMQSGKEGTSLAE
ARASITVLDALHMVAAAWAKVPRQLILSSFVQEGLAPGKTPLSLDKDTEMSPVPSGLSQEEFSHFVDLEDEDPGPRVCKEETGTEDSGREEDGFEPLPTKADALQALCTL
RRWLECNSASPELFEKFYDCEVEVEQLCCL*
24 >lcl|NP_997151.2|Plus11839482..1842049 NT_082868 coiled-coil domain-containing protein 87 Ccdc87 __SEG__ Chr19 {Mus musculus} MEPHSQEPDLKPIYHRLLSPLSLFPSKAKPPPEPPKRPSQDATPLQSIPLAKLKVGPLCRQVSKRLASSGRAARVTAKDRLRLTEVILEELKCNWREPPIEPILDYENNQ
KLRQRLESYVLISSEQLFVRYLHLLVTLPTSRRVFTESATLSRLAVNLARDCTVFLTSPDVYRCLLADFQTLLNLKHAQGGIVKLRPPPCPPGTFKLCPIPWPHSTGLDH
MPCSSLNLNYLVQLSRPYDFPSEPEPDPVEELKSIPQLKSRQQLLWVPSMIKDKEIESRPSPMVPLPSHSPSSESHQFPTSPVHSWLQRGQSMPCLHEGWSLADELCLLP
PSPHPLTPLILASESKPLPFRDIVAEDLKQKMKIMRMEWSRYSLLDSGLPPLLGVLTRRLTAQHHLEKLQQMIKSLQEEEASGKWDLQPPRIIPLHPQPVTVALKVHDQV
IVQVATVQLSERYFNDSFHVEGAGVLYNHLTGELDGKAIEEMDADRLVGNTTGEVYKELMSRVSVSHLSFEEGDQIEPSADKDWSSYLASSFLHQDKHMPIINRNLVGFY
SRRTSTPKPVPEKVPSLTLLPRHKSWDKRPNRHGVWMNWLKPSVSSEDYFKYLSFQESDFLHVIFQMYEKEAPVEVPVPVQEYLDIQQPPPLLQDEELEFMQGKWDWSSV
IEDGSGPGRAYIHNLQQRLKRLWVMLEVPEQNRLDMVIKYSSNARLQQLPALIKAWEQVLKPIQKRESLLGRLEWFEQQASDPNRFFQKPDLLMNRLLEENRFRSYLQRK
LNRMESNLVSLLERIESVFGEPVTFKGRSYLKKMKQDKVEMLYWLQQQRRIRNLTQAQKTFRQSCTFTGSSSQALVAPGNTPTTH*
25 >lcl|NP_997161.1|Plus133780053..33781594 NT_039240 tigger transposable element-derived protein 4 Tigd4 __SEG__ Chr3 {Mus musculus} MAEASVDIGTQPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPML
RLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPSTVWYQNVLPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFKGETCSVGKLCKDRITLALGT
NMDGSEKLPLLIIGKNRAPRCFKGIKSLPVYYEANRTAWMTAAIFEQWMQKLDEKFQAQKRRVVIFVDSCPAHPEVKNLKSIELAFFPSCLSSGFAAMNQGVIKSLKIKY
RHCLIKKFLSSVESSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEAGFRSPKGENDTANADAAVALDLTAHAVGAGVEFLEGLSIEEYAALDEDLETCEATQKDDAEW
AGESKQDETGLYTSDEEEEDSGALEVDLPSPSKKDALSAVGTLKRFLRSHDLNDELHGSLADLENFINALSPK*
26 >lcl|XP_001478306.1|Plus1complement(5773512..5773892) NT_039189 programmed cell death protein 5-like Gm3837 __SEG__ Chr1 {Mus musculus} MADEELEALRKQRLAELQAKHGDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKVSEQGLIEILEKVSQQTEKKTTVK
FNRRKVMDSDEDDADY*
27 >lcl|XP_003085131.1|Plus137266802..37267041 NT_039621 cyclin-dependent kinases regulatory subunit 2-like LOC100503893 __SEG__ Chr15 {Mus musculus} MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRQPLPKEQQK*
28 >lcl|XP_485921.1|Plus1complement(3004979..3006361) NT_039424 g2/mitotic-specific cyclin-B1-like isoform 1 Gm5593 __SEG__ Chr7 {Mus musculus} MALRVTRNTKINAENKAKVSMAGAKRVPVTVTAASKPGLRPRTALGDIGNKVSEELQARVPLKREAKTLGTGKGTVKALPKPVEKVPVCEPEVELAEPEPEPELEHVREE
KLSPEPILVDNPSPSPMETSGCAPAEEYLCQAFSDVILAVSDVDADDGADPNLCSEYVKDIYAYLRQLEEEQSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETM
YMTVSIIDRFMQNSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAYVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLCRASKVGEVDVEQHTLAKYLMELSMLD
YDMVHFAPSQIAAGAFCLALKILDNGEWTPTLQHYLSYSEDSLLPVMQHLAKNVVMVNCGLTKHMTFKNKYAASKHAKISTLAQLNSALVQNLSKAVTKAYLQWTATSAD
AVGTMCRLYIGYLPCLLALQ*
29 >lcl|XP_892193.1|Plus16461389..6461625 NT_039606 cyclin-dependent kinases regulatory subunit 1-like Gm6340 __SEG__ Chr14 {Mus musculus} MSHKQIYYSDKYDEEFEYRHAVLPKDIANLVPKTHLMSESEWRKLGVQQSQGWVHYMIHEPEPHILLFPQPLPKKPKK*
30 >lcl|XP_902195.1|Plus121848851..21849189 NT_039413 hypothetical protein LOC622446 Gm6323 __SEG__ Chr7 {Mus musculus} MSDAAVDTNSEITTKDLKEKKEAVVEKAENGRDAPGNRNGQNEGNGEQEADNEVDEEEEEGGNEEEEEGDGEEEGVDEDEEAEAPTVKWIAKDDEDDNVDTKKQNLNVVT
LE*