SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul D    

ID / Description / Sequence
1 >lcl|XP_001083176.2|Plus1complement(239547..241253) NW_001122935 jerky protein homolog isoform 2 JRK __SEG__ Chr8 {Macaca mulatta} MASKPAAGKSGGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYNADETGLFWRCLPNPTPEGGAVPGLKQSKDRLTVLM
CANATGSHRLKPLAVGKCSGPRAFKGIQHLPVAYKAQGSAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVFTIFLPASVASLVQP
MEQGIWRDFMRNFISPPTPLQGPHARYNMNDAIFSMACAWNAIPGHVFRRAWRKLWPSVVFAEGSSSEEEVEAEHFQAKPHNTSFAHILELVKEGSSCPGQLCQCQAAGW
GVAGREAEGGQPPAATLPAEVVWGSEKTPKADQDGGGDPGEGEEAAWEQAAVAFDAVLRFAERQPCFSAQEVGQLRALRAVFRSQQQVRRWRGALGAVVKVEALQEGPGG
CGATAHSPLPCSSTAGDN*
2 >lcl|XP_001084233.1|Plus1complement(2689873..2691240) NW_001118164 keratin, type I cytoskeletal 18-like LOC695597 __SEG__ Chr5 {Macaca mulatta} MKNPSSRRHRSAKPESGRLTFLLYSISFTTRSTFSTNYRSLGSVQAPSYGTPPVSSAASVYASARGSGSRISVSRSTSLRGGMRSGGLASGMAGGLAGMGGIQNEKETMQ
SLNECLASYLDRVKSLEMENGKLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNACFAADDFRVKYETELAMRQSVEKDIHGLHKVIDDTNVT
RVQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLIVEVDAPKSQDLAKIMADIWAQYDELARKNREELDKYWSQQTEESTTVVTTQSAEVGAAETTLTELRGTVQS
LEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESEMAQTRAERQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTRQIVD
GKVMSETNDTKVLRH*
3 >lcl|XP_001084989.1|Plus15387444..5388061 NW_001104501 mitotic spindle assembly checkpoint protein MAD2A MAD2L1 __SEG__ Chr17 {Macaca mulatta} MELQLSREQGTTLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIERGEVLERWQFDIECDKTA
KDDSAPREKSQKAIQDEIHSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEELGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND*
4 >lcl|XP_001085140.1|Plus1complement(3702328..3703866) NW_001118162 tigger transposable element-derived protein 4 TIGD4 __SEG__ Chr5 {Macaca mulatta} MAEASADASTLPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPML
RLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGVSVDPSTVWYQNVLPYYLNDYHPKNVFNIKETGLLYRMLPTNTFAFKGETCSVGKLCKDRITLVVGT
NMDGSEKLPLLVIGKKRNPHCFKGLKSLPVCYEANRMAWMTSDVFEQWMRKLDEKFQAQQRRVVIFVESFPAHPEVKNLKSIELAFFPSCLSSKCIAMKQGIIKSLKIKY
RHCLIKKFLSSVEGSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEAGFKSQKGESDVTSAEKDTGLDLVADAVGAGVEFPEGLSIEEYAALDDDLETCEAAPNGDSVC
TKESKSDETGFYTSDEEDDDGCPGTELPSPSKSEAITALDTLKKFLRSQDMNDGLQNSLADLENFINSLSTK*
5 >lcl|XP_001085686.1|Plus1complement(5269311..5269676) NW_001098161 uncharacterized protein C11orf51 homolog isoform 2 LOC695622 __SEG__ Chr12 {Macaca mulatta} MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSMAEKDNNLVPLGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNELDVE
GNQQDQDQWMI*
6 >lcl|XP_001085756.1|Plus1complement(2128346..2129875) NW_001218164 nucleosome assembly protein 1-like 3-like isoform 2 LOC697636 __SEG__ ChrX {Macaca mulatta} MAEADFKMVSEPVAHGVAEEEMASSTSDSGEESDSSSSSSSTSGSSSGSSSSGSSSSSSGSGSSSSSGSTSSRSRLYRKKRVPEPSSRARRAPLGTNFVDRLPQAVRNRV
QALRNIQEECDKVDTLFLKAIHDLERKYAELNKPLYDRRFQIINAEYEPTEEECEWNSEDEEFSSDEEVQDNTPSEMPPLEGEEEETPKENPEVKAEEKEVPKEIPEVKD
EEKEVPKEIPEIKAEEKADSKADCMEATPEVKEDPKEAPQVKADDKEQPKATEAKARPAVREAHKRVPEERLQDSVDLKRARRGKPKREDPKGIPDYWLIVLKNVDKLGP
MIQKYDEPILKFLSDVSLKFSKPGQPVSYTFEFHFLPNPYFRNEVLVKTYIIKSKPDHNDPFFSWGWEIEDCKGCKIDWRRGKDVTVTTTQSRTTATGEIEIQPRVVPNA
SFFNFFSPPEIPMIGKLEPREDAILDEDFEIGQILHDNVILKSIYYYTGEVNGTYYQFGKHYGNRKYRK*
7 >lcl|XP_001086358.1|Plus1complement(2897760..2899052) NW_001098169 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr12 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLES
KIREHLEKKGPQVRDWSHYFKIIEDLRVQIFANTVDNARIVLQIDKARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNVTRLQLETEIEALEEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMVDIRAQYDEMARKNREKLDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTFQSLPINLDSMRNLKASLENSLREVEAR
YALQMEQLNGILLHLESELAQTRTEGQRQAQEYEALLNIKVKMEAEIATDRCLLEDGEEFNLGDALDSSNSTQTIQKTTTCQIVDGKVVSETNDTKVLRH*
8 >lcl|XP_001087253.1|Plus1846714..847043 NW_001122903 hypothetical protein LOC698256 isoform 1 LOC698256 __SEG__ Chr8 {Macaca mulatta} MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVDEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDKDD*
9 >lcl|XP_001088181.1|Plus16050813..6052105 NW_001114282 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr3 {Macaca mulatta} MSFTTRSTFSTSYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDTVRSLETENRRLES
KIQEHLEKKGPQVRDWSHYFKIIEDPRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNVTQLQLETEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETMLTELRRTVQSLEIDLDSMRNLKASLENSLREVEAR
YALEMEQLSGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH*
10 >lcl|XP_001088644.1|Plus1complement(3175891..3176190) NW_001124216 translationally-controlled tumor protein-like LOC697631 __SEG__ Chr9 {Macaca mulatta} MNHHLQETSFTKETCKKYIKDYMKSVKGKLEEQRPERVKPFMTGAAEQIKHILANFKNSQFFIGENVDPDGMVALLDYREDGVTPYMIFFKDGLEMGKC*
11 >lcl|XP_001089502.1|Plus1complement(3917675..3918193) NW_001105665 centrin-1 CETN1 __SEG__ Chr18 {Macaca mulatta} MASSFKKPSAAPTSQKRKLAPKPELTEDQKQEVREAFDLFDADGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEGTGKISFNDFLAVMTQKMSEKDTKEEILKAF
RLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTNLY*
12 >lcl|XP_001089560.1|Plus1complement(964234..965625) NW_001218185 DDB1- and CUL4-associated factor 12-like protein 2-like LOC700397 __SEG__ ChrX {Macaca mulatta} MAQQQTGSRKRKAPAVEAGAGSSSSQGLAAADGEGPLLPKKQKRPATRRRLVHYLKGREVGARGPAGLQGFEGELRGYAVQRLPELLTERQLDLGTLNKVFASQWLNARQ
VVCGTKCNTLFVVDVQSGHITRIPLMRDKEAGLAQAQQGCGIHAIELNPSKTLLATGGENPNSLAIYQLPTLDPLCLGDRHGHKDWIFAVAWLSDTVAVSGSRDGTVALW
RMDPDMFNGSIAWHSEVGLPVYAHIRPKDVEAIPRASTNPSNRKVRALAFSGKNQELGAVSLDGYFHLWKARSTLSRLLSIRLPYCRENVCLTYCDELSLYAVGSQSHVS
FLDPRQRQQNIRPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQKFLEERASASLDSTPGPAGRKLKLACGRGWLNQDDVWVNYFGGMEEFPNALYTHCYNWPE
MKLFVAGGPLPSGLHGNYAGLWS*
13 >lcl|XP_001090279.2|Plus18404495..8404977 NW_001124223 translationally-controlled tumor protein-like isoform 1 LOC702001 __SEG__ Chr9 {Macaca mulatta} MFCDIYKIQEIMDGLCLDVEGKMVSRTEGNIDDSLIRGNASTEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYIKSIKGKLEEQRPERVKPFMTGAAEQI
KHILANFKNYQFFIGENMNPDGMVALLDYCEDGVTPYMIFFKDGLEMEKC*
14 >lcl|XP_001090336.2|Plus14614139..4615584 NW_001116512 keratin, type II cytoskeletal 8 isoform 3 KRT8 __SEG__ Chr4 {Macaca mulatta} MSIRVTQKSYKVSTSGPRAFSSGSYTSGPGALISSSSFSRVGGSSFRGGLGGGYGGASGMGGITAVTVNQSLLSPLNLEVDPNIQAVRTQEKDQIKTLNNKFASFINKVR
FLEQPNKMLETRWSLLQKAARSNMDNMFESYINNFRRQLETLGQEKLKLEAELGNMHGLVENFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVEMESCLEGLTDEIN
FLRQLYEEEIQELQSQIWDTSVVLSMHNSRSLDMDSIIAEVKAQYKEIANRSRAEAESMYQIKYEELQSLAAKHGDDLRCTKTEISEMNRNISRLHAEIEGLKGQRASLE
AAIADAEQRGELAIKDANAKLSELEAALQRAKQNMARQLREYQELVNVKLALYIEIATYRKLLEGEESRLESGMQNMSLHMKTTSGYAGGLSSAYGGLTSPGLSYGLGSS
FGSGAGSSSFRRTSSSRAMVVKKIKTCNGKLVCESSDLLPK*
15 >lcl|XP_001090509.1|Plus12896875..2897612 NW_001218196 sperm protein associated with the nucleus on the X chromosome N2-like LOC702242 __SEG__ ChrX {Macaca mulatta} MQETPNRDLAPEPSLKKMKTSEYPTVLVFCYRKVKKINSNQLENDQSRENSINPVQEEEDEDLDSAEGSSQEDEDLDSSEEFSKQDEELELLEGSSQEDEDLDLPEGSSK
QDEELDLLEGSSEEDEDLDLPEGSSQEDEDLGLSEGSAQEDEDLDLSERSSHEDEDLDSAEGYSQEDEDLDLPEGFSQEYEDLGLYEGYSQEDEDLDPSEGYAQEDKDLD
SAEGYSMEDEDPGLSEGSSQEGEEN*
16 >lcl|XP_001090778.1|Plus1106718..109120 NW_001102926 serine/threonine-protein kinase haspin GSG2 __SEG__ Chr16 {Macaca mulatta} MAASPPGFGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRRKLRARP
SLTVTPRRLGLRTRPPQKCSTPCGPLRLPPFPSRDPGRLSPDLSACGQPRDGDEVGTSASLFSSLASPGPGSPTPRDRAISIGTSASLVAASAVPSGLYLPEVSLDQASL
PCSQEEATGGVRLTRMVHQTRASFRSAIFGLVNSGTPEDSEFGADGKNMRESCSKRKLVGSGPECPGLSNTGKRRATGQVSCQERALQEAVPREHQEASVSKGRIVPGGI
DRLERTRPSRKSKHQEARETSLLHSHHFKKGQKMRKDSFPTQDLTPLQNASFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSECSNRHVMNKTSGALSSWHS
SSMYLLSPLNTLSISNKKASDAEKVYGECNQKGPVPFSHCLPTEKLQCCEKIGEGVFGEVFRTIADHAPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGE
VCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYHSTKGSANDRPDFFKDDQLFIVLEFEFGGTDLEQMKTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLK
KTSLKELHYTLNGKSSTIPTRGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNCWGEYHPYSNVLWLHYLTDKILKQMTFKSKCNTPAMK
QIRKQIREFHRTMLNFSSAADLLCQHSLFK*
17 >lcl|XP_001093470.1|Plus1complement(2592253..2592870) NW_001114277 mitotic spindle assembly checkpoint protein MAD2A MAD2L1 __SEG__ Chr3 {Macaca mulatta} MALQLSREQGITLHRSAEIVAEFFSFIINSILYQRGIYPSETFTRVQKYGLTLLVTTDLQLIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERRQFDIECDKTA
KDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEELVPQFITNSEEVRLHSFTTTIHKVNSMVAHKIPVND*
18 >lcl|XP_001094262.1|Plus12145139..2146713 NW_001100390 jerky protein homolog-like JRKL __SEG__ Chr14 {Macaca mulatta} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGL
HKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGV
IATMKRNYRAGLLQNNLEEGNDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMIEEKESLDFDDEDISVATVATLLQHTKGLENVTTENLEKWLEVDSTEPG
YEVLTDSEIIRRAQGQTDESSENEEEEIELIPEKHINHAAALQWTENLLDYLEQQGDMILPDRLVIRKLRATIRNKQKMTKSSQ*
19 >lcl|XP_001095046.1|Plus1complement(279226..280614) NW_001218141 nucleosome assembly protein 1-like 2-like isoform 3 LOC701017 __SEG__ ChrX {Macaca mulatta} MAESANHKELSESSQQEAGNQIMVEGPGEHPERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSGEDGKKGEDTDKDSDPDRPKGLIGYVLDTDFVESLPVKVKY
RVLALKKLQTRAANLESKFLREFHDIERKFAEMYQPLLEKRRQIINAIYEPTEEECEYKSDSEDYDDEEMCDEEMYGNEEGMVHEYVDEDDGYEDYYYDYAVEEEEEEED
EDEDDIEATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKFSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLAYYDPHPYRGTAIEYS
TGCEIDWNEGKNVTLKTIKKKQKHRIWGTIRTVTEDFPKDSFFNFFSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWM
AAIEEVKACCKNLEALVEDIDR*
20 >lcl|XP_001096876.1|Plus1complement(2814783..2815022) NW_001105662 cyclin-dependent kinases regulatory subunit 1-like isoform 1 LOC705082 __SEG__ Chr18 {Macaca mulatta} MSHKQIDYSDKYDDEEFEYRHVVLPKDIAKLVPKTRLMSESEWRNLGIQQSQGWVHYMIQEPEPHILLFRRPLPKKPKK*
21 >lcl|XP_001097510.1|Plus13771353..3771871 NW_001101659 translationally-controlled tumor protein TPT1 __SEG__ Chr15 {Macaca mulatta} MIIYRDLISHDEIFSYIYKIREIADGQCWEVVGKMVSRIEGIIDDSLIGGNVSAEGPEGEGTKSTVITAVDIVMNHHLQETSFIKEAYKKYIKDYMKSIKGKLEEQRPER
VKLFMTGAAEQIKHIPVNFKNYQFCIGENMNSDGMVALLDYREDGVTPHMIFFRDGLEMEKY*
22 >lcl|XP_001097629.1|Plus14822061..4822543 NW_001116518 m-phase phosphoprotein 6-like LOC704129 __SEG__ Chr4 {Macaca mulatta} MVAERKTKLSKNLLRVKFMQRGLDSETKKQLEEEEKKIISEDHWYLDLPELKEKESFIIEEQSFLLCEDPLYGRMSFRGFNPDVEKLMLQMNAKHKAEEVEDETVELDVS
DEEMARRYETLVGTIGKKFARKRDHANYEEDENGDIKPIKAKKMFLKPQD*
23 >lcl|XP_001098060.1|Plus111462336..11463628 NW_001114280 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr3 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSCSAQQVSSAAGVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDHRASYLDRVRSLETENRRLES
KIWEHLEKKGPQVRDWSHYFKIIEDLRPQIFANTVDNARIVLQIDNAPLAADDIRVKYETELAMRQSVENDIHGLRKVIDDTNVTRLQLEAEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQTEESTTVVTTQSAKVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEAH
YALQMEQLNGILLHLESELAQTRAEGQRQAQKYEALLNIKVKLEADIATYRRLLEDGEEFNLGDALDSSNSMQTIRKTTTRRIVDGKVVSETNDTKVLRH*
24 >lcl|XP_001098135.1|Plus1323103..323348 NW_001124197 NEDD8 isoform 1 NEDD8 __SEG__ Chr9 {Macaca mulatta} MLIKVKTLTGEEIDIDIEPTDKVERIKERMEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILSGSVLHLVLALRGGSGLRQ*
25 >lcl|XP_001100967.1|Plus1complement(3746914..3747462) NW_001118154 nucleosome assembly protein 1-like 5 NAP1L5 __SEG__ Chr5 {Macaca mulatta} MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYN
DIYKPLLAKIQELTGEMEGCAWTLEGEEEEEEEYEDDEEEGEEEEEEDAAAEAAAGAKHDDAHAEMPDDAKK*
26 >lcl|XP_001103652.1|Plus1complement(13313478..13314653) NW_001108704 nucleosome assembly protein 1-like 1 isoform 1 NAP1L1 __SEG__ Chr1 {Macaca mulatta} MADIDNKEQSELDQDLDDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
QPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEP
NEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFL
RERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ*
27 >lcl|XP_001106751.1|Plus12067636..2067875 NW_001104442 cyclin-dependent kinases regulatory subunit 1-like LOC709952 __SEG__ Chr17 {Macaca mulatta} MSHKQIYYLDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIQEPEPHILLFRRPLPKKPKK*
28 >lcl|XP_001108579.1|Plus1260004..261296 NW_001111343 keratin, type I cytoskeletal 18 isoform 1 KRT18 __SEG__ Chr20 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGVSGSRISVSRSTSFGGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLES
KIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNVTRLQLETEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELAGKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSPREVEAR
YALQMEQLNGILLHLESELAETRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH*
29 >lcl|XP_001108825.2|Plus1complement(4..582) NW_001106646 mps one binder kinase activator-like 2A-like LOC717390 __SEG__ Chr19 {Macaca mulatta} MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKP
TALSAPRYMDLLMDWIEAQINNEDLFPTNVGESVVGRGSGIHSLPEKSGRPSTVAHTRNASALGGRAQGSLEPRSLSSAWAT*
30 >lcl|XP_001109081.1|Plus1complement(21157447..21157686) NW_001108704 cyclin-dependent kinases regulatory subunit 1-like LOC711546 __SEG__ Chr1 {Macaca mulatta} MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVRYMIHEPEPHILLFRRPLPKKPKK*
31 >lcl|XP_001110775.1|Plus1complement(8136868..8137518) NW_001120983 mps one binder kinase activator-like 1B-like isoform 3 MOBKL1B __SEG__ Chr6 {Macaca mulatta} MSFLFSSCSSKTFKLKKNIPEGSHQYELLKHAEATLGSENLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCS
APKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYGHIYHQHFDSVMQLQEEAHLNTSFKHFIFFDQEFNLIDRCELAPLQELIETFGSKDR*
32 >lcl|XP_001112392.1|Plus1416908..417426 NW_001109071 translationally-controlled tumor protein isoform 1 TPT1 __SEG__ Chr1 {Macaca mulatta} MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTQSTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPER
VKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC*
33 >lcl|XP_001113136.1|Plus11741533..1742456 NW_001102959 cyclin-dependent kinase 5 activator 1 isoform 2 CDK5R1 __SEG__ Chr16 {Macaca mulatta} MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPP
ASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDH
ELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESSQEDKKRLLLGLDR*
34 >lcl|XP_001114823.2|Plus1complement(<6..1049) NW_001100989 tigger transposable element-derived protein 3-like LOC719953 __SEG__ Chr14 {Macaca mulatta} MELSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELA
DIMGQDFVPSIGWLVRWKRRNNVGFGARHVLTPSFPPEPPPPGLTSQAQLPLSLKDFSPEDVFGCAELPLLYRAVPGNLGACDQVQVLLCANSRGTEKRRVLLGGLQAAP
RCFFGVRSEALPASYHPDLGVPWLEWLAQFDRDMGQQGRQVALLLAARVVEGLAGLPGLYHVKLLPLAASSTTPPLPSSVVRAFKAHYRHRLLSKLAAIQSDRDGTSLAE
AAAGITVLDALHVASAAW
35 >lcl|XP_001114854.2|Plus11510..2415 NW_001218964 baculoviral IAP repeat-containing protein 4 XIAP __SEG__ ChrX {Macaca mulatta} MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFADFPSSSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENSATQSTNSGI
QNGQYKVENYLGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEH
RRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIITFGTWIYSVNKEQLARAGFYALGKLYYKTNK*
36 >lcl|XP_001115680.1|Plus19533..10252 NW_001111080 glucocorticoid modulatory element-binding protein 1-like LOC720327 __SEG__ Chr1 {Macaca mulatta} LFFFSIDLERQLEEQKKQAQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQ
LFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVA
EMEEHQHQVHNVEIVVLED*
37 >lcl|XP_001116469.1|Plus1complement(581961..582617) NW_001108960 SAP domain-containing ribonucleoprotein-like isoform 1 CIP29 __SEG__ Chr1 {Macaca mulatta} MATETVEFHKLKLAELKQECLACGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDETEEEETKPIELPVKEKEPPEKTVDVAVEKKVVKITSEIPQTERMQKRAEQI
LTLYVRVRKLTLSKEGKKAARAARFGISSVPTKGLSSDNKPMVNLDKLKETAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAECFGIA*
38 >lcl|XP_001116587.1|Plus1complement(739..>1005) NW_001098706 cyclin-dependent kinase 5 activator 2-like LOC720778 __SEG__ Chr12 {Macaca mulatta} PLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPNGGASAASSAARDSCAAGAKHWTMNLDR*
39 >lcl|XP_001116807.1|Plus1complement(330..875) NW_001102826 sulfhydryl oxidase 2-like LOC720880 __SEG__ Chr15 {Macaca mulatta} HLSEDPRFPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQHYTRDNLLDTYSADQGDSGEGGALARGEEEEKRLAPPEMSRGERDAQSVRPPSVLGPRPALPDSLHH
SLDVKLQDPDGPGVHKEVGGAAPFLGVDFSSLDMSLCVVLYVASSLFLMVMYFFFRVRSRRWKVKHHHPAV*
40 >lcl|XP_002801532.1|Plus1complement(<1009..>1452) NW_001108090 relA-associated inhibitor-like LOC722412 __SEG__ Chr19 {Macaca mulatta} TELEPELEIEGLLTPVLEAGDVDEGTVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPGGPEPELS
TITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQLQSM
41 >lcl|XP_002802417.1|Plus1complement(551785..553434) NW_001111313 tigger transposable element-derived protein 7-like isoform 1 LOC100428553 __SEG__ Chr20 {Macaca mulatta} MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRKRTTGAKYGDVDDAVYMWYQQKRSAGVPVRGVELQAAAERF
AQCFGRTDFKASTGWLFRFRNRHAIGNRKGCGEQVLSSVSENVEPFRQKLSMIIKEEKLCLAQLYSGDETDLFWKSMPENSQASRKDICLPGKKINKERLSALLCANADG
THKLKSIIIGKSKLPKSVKEDTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHFQLNVLRFHEEDIRALLLLDSCPAHPSSESLTSEDGRIKCMFFPHNTSTLIQPM
NQGVILSCKRLYRWKQLEESLVIFEESDDEQEKGDKGVSKIKMYNIKSAIFNWAKSWDEVKQITIANAWENLLYKKEPEYDFQGLEDGDYREILEKCGELETKLDDNRVW
LNGDEEKGCLLKTKGGITKEVVQKGGETEKQTAEFKLSAVRENLDYLLDFVDATPEFQRFHFTLKEMQQEIVKKQFQSKIRSRTGSFLKPRPHDIKDSFSGPSTSGSNH*
42 >lcl|XP_002804541.1|Plus110006455..10006787 NW_001120982 hypothetical protein LOC702864 LOC702864 __SEG__ Chr6 {Macaca mulatta} MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDNVDTKKQKTDEDD
*
43 >lcl|XP_002804632.1|Plus1complement(3310723..>3311769) NW_001120988 tigger transposable element-derived protein 6-like LOC710090 __SEG__ Chr6 {Macaca mulatta} DIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRLTALFCCNASGTEKMRPLIVGRSASPRCLKNIHSLPCDYRANQWAWMTRDLFNEWLMQVDARMKRAERRILLLI
DNCSAHNMLPRLERIQVGYLPSNCTAVLQPLNLGIIHTMKVLYRSHLLKQILLKLSSREDQEKVDIKQAIDMIAAAWWSVKPSTVVKCWQKAGIIPMEFAECDIESAASE
PDTAIEKLWHTVAIATCVPNEVNFQDFVTADDDLIISQDTDIIQGMVAGENTSEAGSEDEGEVSLPQQPKVTITEAISSVQKLRQFLSTCVDVPDAIFGQLNGIDEYLMK
RVTQTLVDSKITDFLQTK*
44 >lcl|XP_002805279.1|Plus186..>1078 NW_001121579 cell cycle control protein 50B-like LOC719590 __SEG__ Chr7 {Macaca mulatta} MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDSGTSNCSVCAEAGQGRAPPPPCSCAWSFSLPELFQGPVYL
YYELTNFYQNNRRYGVSRDDEQLSGLPSALRHPVNECAPYQLSAAGLPIAPCGAIANSLFNDSFSLWHQRLPGGLYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAF
QGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCIL
T
45 >lcl|XP_002805867.1|Plus18404528..8404977 NW_001124223 translationally-controlled tumor protein-like isoform 2 LOC702001 __SEG__ Chr9 {Macaca mulatta} MDGLCLDVEGKMVSRTEGNIDDSLIRGNASTEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYIKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQ
FFIGENMNPDGMVALLDYCEDGVTPYMIFFKDGLEMEKC*
46 >lcl|XP_002808189.1|Plus1complement(2532398..2533690) NW_001104434 LOW QUALITY PROTEIN: keratin, type I cytoskeletal 18-like KRT18 __SEG__ Chr17 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLES
KIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVSDDTNVTRLQLETEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRA*YDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEAR
YALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTHRIVDGKVVSETNGTKVLRH*