SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom D    

ID / Description / Sequence
1 >lcl|XP_001362224.1|Plus11319035..1322736 NW_001582019 structural maintenance of chromosomes protein 1A-like LOC100009927 __SEG__ Chr8 {Monodelphis domestica} MGFLKLIEIENFKSYKGKQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKTLRDLIHGAPVGKPAANRAAVSMVYSEDSGEDRTFARIIVGGSSEYKINNK
VVQLLEYSQELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKDEVVRAQ
VQLQLFKLYHNEMEIEKLNKELTSKNKEIDKEKKRMDKVEEELKEKKKELGKMMREQQQIEKEIKEKDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKQYKKRK
GDMDELEKEMVSVEKARQEFEDRMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEE
YITTSKQSLEEQKKLEGELTEEVKLAKQRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSE
KTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGASDLK
AKARRWDEKAVDKLKEKKERLTEELKEQMKAKRKEAELRQVQSQAHGLQMRLKYSQSDLEQTKTRHLALNLQEKSKLESELANFGPRINDIKRIIQGREREMKDLKEKMN
QVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAK
KSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLAKGTMDDISQEEGSSQGEESGSGSQRTSNIYAREALIEIDYSDLCEDL
KDAQAEEEIKQEMNTLQQKLTEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKHAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGP
ENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGVYPEQGDC
VISKVLTFDLTKYPDANPNPNEQ*
2 >lcl|XP_001363070.1|Plus1complement(1711738..1712823) NW_001581994 cyclin-dependent kinase 5 activator 2-like LOC100010786 __SEG__ Chr7 {Monodelphis domestica} MGTVLSLSPASSAKGRRPGGLPDEKKKPQPSAGEESLGGYGQLPSGKGSKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPAQAGSDLLVQQRNRENLLRKGR
EPPDGGGASKPLPVPVPTVPTTAEPTSGVSVSAPPGSGGGGGKPPPPPPPAAPQAPSVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLL
LQGWQDQAFITPANLVFVYLLCREALRGDELGSAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSAQMLRLNADPHFFTQVFQDLKNEGEV
GMGAGGPTGGAATNARDSNAGAKHWTMNLDR*
3 >lcl|XP_001363342.1|Plus1408745..409032 NW_001581876 casein kinase II subunit beta-like LOC100010330 __SEG__ Chr2 {Monodelphis domestica} MLPIGLPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTDFPQTLFMVPPEYRPKPPANQFVPRLYGFKIYPMVYQLQLQAASNFKSPPQHLRL*
4 >lcl|XP_001365701.2|Plus17335994..7336500 NW_001581992 centrin-2-like LOC100011661 __SEG__ Chr7 {Monodelphis domestica} MASNSQSSTWRRRKPKVTVELSEGQKREIKETFNFFDVDGSGNIDLKELKTAVCALGFEPKKEEIHKMMAEIDKEGLGTMNFESFLTVITTKMREKDEKEQLLKAFKLFD
DDNTGCITLKNIKKVAKELGENLSDDELQEMLDEAGRSGNGKLNEREFLKIMKKTSLY*
5 >lcl|XP_001365787.1|Plus119315790..19316308 NW_001581894 centrin-2-like LOC100017394 __SEG__ Chr3 {Monodelphis domestica} MASTTKKPNMGPSLPRRKLEPKPELSEDQKQEIREAFDLFDTDGTGTIDVKELKVAVRALGFEPKKEEIKKMISEVDKEGTGKISFNDFLAVMTQKMNEKDTKEEILKAF
KLFDDDDTGKISFKNLKRVARELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKSSIY*
6 >lcl|XP_001367318.1|Plus1complement(670453..672030) NW_001581963 jerky protein homolog-like JRKL __SEG__ Chr4 {Monodelphis domestica} MSGKRKRVVLTIKDKLDIIKKLEEGSSSKQLSVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPVSGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRGEKLNGDENVVDAFCSHFREFFKRENLHPEQIYNADETGLFWKCLPTRTSAAKGKFTASGRKLIEERVTVMCCANATGL
HKLKLCVVGKAKKPRSFKGTDTSNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFVKYLPPNVASLIQPMDQGV
IAIMKRHYRAGLLQNNLEEGNDLKMFWKKLTLLDALYEISMAWNMVKPVTITRAWNKIFPGNEEKESLDFDEEEISAAALATILQHTQGCEKMDTDNIERWFEVDSTEPG
YKVLTDSEIIRRAQGQTDESSENEEEEIELIPEKNINHAAALKWTENLLDYLEQQGDMILPDKLVIRKLRATIRNKQKMTMNPTQ*
7 >lcl|XP_001367585.1|Plus12468089..2469078 NW_001581875 cyclin-A2-like LOC100013182 __SEG__ Chr2 {Monodelphis domestica} MDEPYSEKEFLSPKKVQYEDNILDFNSAVSLPATSKPLVPYDQAMDVSLEVSFPLEMSMKLEAPPQLPNIMEVSDYAEDIYLYLREMEVKYKLNVDYTKNQPGSIDNLRV
LLLNWLMVAGQLLRLQNETLHLAVNYLDRYLSLEAVLHEMLQLLGIAALRLATKFEEAYPLRIVELVYVIAGQYTKNQISGMEHRMLQELAFDLSVPTINQFLTQYLLNQ
QQPNSEVESLAMFLGELCLVDADPYLKYLPSVMAGAARHLALYTVTGKSWPESLVQKRGYTLESLKPCLMDLHQTYLRASQHALQPIPEKYRKAMYHGTIVLIKPSERH*
8 >lcl|XP_001368080.1|Plus1complement(11313264..11314184) NW_001581881 cyclin-dependent kinase 5 activator 1-like LOC100018527 __SEG__ Chr2 {Monodelphis domestica} MGTVLSLSPSYRKATLFEDGSATVGHYTAVQNSKNAKDKSLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPQPTQPPAPS
TNQLSGSQTAVSSVKKAPHPNSIAPGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVATDHE
LQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSIINLMSPKMLQINADPHYFTQVFADLKNECSQEDKNRLLIGLDR*
9 >lcl|XP_001370827.1|Plus1369842..371251 NW_001587042 fizzy-related protein homolog LOC100017192 __SEG__ ChrX {Monodelphis domestica} MSWSLALPPTAPVPSASKYGDRYIPSRVAANWEVHFHSKDESELSSGPKQKTEDSNSGKNRSSLVYSTALKNELLGARIQKAPSLESEENQSPQPCGPTKRNLFTYSPNT
FRWRPEIGSEMSAYAMSPISKSSQTLLTTVQREARIIPKSPFRILEAPELSDDFYLNLLDWSRHNIVAVGLGSTVFLWSATTSQVTELCDLAQEDDAVTSVSWTERGTLL
AVGTQKGVVQIWDADAEKRVATMEGHSGRVSSLAWNGSQISSGSRDRRINQRDIRAYPLQSQRWLQGHKQEVCGLKWSTDHRLLASGGNDNRLLLWNCYSLKPVQKYTAH
KAAVKAIAWSPHQHRLLASGGGSADRCIRFWNTLTGQPLQHVDTGSQVCNLAWSKQDNELVSTHGYSENQIVIWKYPSMTQVAKLTGHLYRVLYLAVSPDGQTIVTGAGD
KSLRFWNVFRKACAQKESASVLSLFTRIR*
10 >lcl|XP_001371985.1|Plus118289859..18290488 NW_001581839 translationally-controlled tumor protein-like LOC100018984 __SEG__ Chr1 {Monodelphis domestica} MITYQDLISHDEMFVNIYKIQEILNGLFLEVEGKLISRTEGTIDDSLIGGNASAEGPEVQVITGVDIVINHHLQENSFTKESYKKYIKDYMKSIKGRLEEQKPDRVKPFM
TGVTEQIKHILANFNNYQFFIGENMNPDGMVALLDFHEDGVTPYMIFFKDGLEMEKCNKFSQLCWVTCHHNWLLLFVIYTTSGLGQISTDITLSFIHLF*
11 >lcl|XP_001372430.1|Plus1complement(35739154..35743401) NW_001581968 structural maintenance of chromosomes protein 4 SMC4 __SEG__ Chr5 {Monodelphis domestica} MPPRKKAKRSTAKAVQEPEEEPPSCGAAAVKRPRKKAKRPAAQALPEPVKVPVPVPEEPPQLEREVAQQSPQWLEEPQLSPQQWQTEAELSPPQLQAVSELSPPQWQPGV
ELSPPQLQPEAELPSLQRQSEAELSPTPWQPEAELSPPQLQPEAAEASPPWLQPELGPGASPRSSQSESEDRLTLEEILAAVPPPPPRGMINKEGTPRLMISHIVNLNFK
SYAGRTQLGPFHKHFSCIIGPNGSGKSNVIDSMLFVFGCRAHKIRSKKLSVLIHHSDDYQDLDSCTVEVHFQKIIDKEGDDYEVIPNSSFYVSRTAYKNNTSVYHISGKK
QTFRDVGNLLRSHGIDLDHNRFLILQGEVEQIALMKPKGQSEHDEGMLEYLEDIIGCGRLKEPIEVLSQRLDVLTEEREEKLNRVKIVEKERNYLEIEKNLAIDFLTIEN
EILTKKNHICQFYIYDLHKRIAEVEYEKDKILEETEAIKKKTSKLEGEMNAKTNALEEAERKLNQVATFIEENKEKYTQLDLEGVQVKTKMKYAKTKARKLEKQLQKDKE
KVEEFKDVPAKSEKVITETTTKKSTLEEEREKEEEKMKQVMDSLKQETKELQEEKESQEKELMEFNKTVNEARSKMDVAQSELDIYLSHHNTAVSQLSEAQKALTTASET
LKERKTAIRDIEMKLPPTEQDLKEKESELQNLTKEARDLDSSIRDLLQKVEEAKSSLATNQSRGKVLNALIQQKLSGKIQGIYGRLGDLGAIDEKYNIAISSCCSALDYI
VVNTIDTAQVCVNFLKKQNIGVATFIGLDKIKVLEKNMNPLQTPENIPRLFDLVKAKDENIRRAFYFALRDTLVADNLDQATRVAFQKDKRWRVVTLQGQIIEQSGTMTG
GGSKPMKGRMGSSLVMEVSEEEVANMESILRRDSQRAIEVQERKAQLEEAMIKLRHSVQDMRNTLEKFTVSIQSLSEQEAYLNAQVKELKANVCDTVPDKNKQKFLETQI
NTFKKEYECVALKAGKVEAEVKRLHNLIMEINNHKLKSQQDKLDKINKQLDQCASSITKAQVGVRTANRNLKKAQDSVLRTEKEITDNDKEMEDFTQELEDLEEKATEIM
KNSKEAGESLPEIQREHNNLVKEMKVIKENECSLQNDALSNKLKLEQVDSYIAEQHSKVRFWEKEMSRIALHPIENNQAEQISLLSQEDLEEIGNPNFLNNQIELLESQC
NAMNPNLDSIEEYKKKNQQYLHRVAELEKITIERDRYRRAYKDLRERRLNEFMAGFTIITNKLKENYQMLTLGGDAELELIDSLDPFSEGIMFSVRPPQKSWKKIFNLSG
GEKTLSSLALVFALHDYKPTPLYFMDEIDAALDFKNVFIVAYYIYKQKKDAQFIIISLRNNMFEIADRLIGIYKTNNVTKSVTINPKAIAAKGVC*
12 >lcl|XP_001372495.1|Plus1complement(33126187..33128313) NW_001581900 mitotic spindle assembly checkpoint protein MAD1-like LOC100019739 __SEG__ Chr3 {Monodelphis domestica} MENLEENTAVLSSLRTLKDFISKPDVEGGSSLNVQYQQSMQLEERAEQIRSKSHLIQVEREKIQMELSHKRARVELEKAATTNARNYEREADRNQELLTRIKQLHERQVE
MENKLKEQAEINRSCKQNLDTANKKLQEKENKLAEANETISELKGKISELQWNIMNQEMQVKNLESQKQELMEQLDVQNKKCQETNQRVQELQANQCLIVDNEQKIKELE
QKLSLQEQDAAIVKNMKSELVRFPKMEREVKQLREENAYLREMKENSGLLKEEVEGLQRKLERHEKLQEDMVALELEKEKLLEKLKSWERMDQSMGLNIRTPEDLSNYIV
ALQQRELELTDKSTSITSSARILEKMRQQLQEDLLKVQSQLVEERKKREYNEGLARRLQKRVFLLTKERDVMRSILNSFENDLSPAEHSPQLTLQVREAEDMVQNLHAHS
AEMEVQLSQALEELGEQKGRADMLEVELKILKSQTGSVDQILFVSNDELNALRLKVEELVTARNKLEEEKKNLEMQLEQLTLQGYYDQSKTKVIHLSKNPASLAKGRLKM
EQQQLQEECQQLQELVRVLEGGGTIPNKLEGVGCLQPSQEISDLKKQLESAELKNQRLKEVFQTKIQEFRKVCYTLTGYRIDFTTENQYRLTSMYAEHKSDCLIFKASSP
SRTKMQLLETEFSRTIPELIDLHLLQQDSIPVFLSSVTLDLFSRQTIT*
13 >lcl|XP_001372507.1|Plus121381934..21382821 NW_001582018 caspase-6-like LOC100019753 __SEG__ Chr8 {Monodelphis domestica} MTTRDACGRDFSAPGDAEQNATEIDAFFKSKPLDPAEQYKMDHKRRGVALIFNHERFFWHLTLPERRGTRADRDNLRQRLSDLGFEVNCFDDLKAEDLLMTIHMVSTSSH
IDADCFLCVFLTHGEGNHIYAYDAKIDIQKLTAMFKGDKCQTLVGKPKIFVIQACRGDQHDIPVIPLDVVDHLSDKVDVNETEVDAASVYTLPAGADFLMCYSVAEGYYS
HRETVHGSWYIQDLCEMLEKYGSSLEFTELLTLVNRKVSQRRVDFCKDPNAIGKKQVPCFASMLTKKLYLFPKPK*
14 >lcl|XP_001373060.1|Plus16282228..6285167 NW_001581997 MORC family CW-type zinc finger protein 2-like LOC100020631 __SEG__ Chr7 {Monodelphis domestica} MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELLDNARDAEATRIDIYAEYRENLQGGFMLCFLDDGTGMDPSDAASVIQFGKSAKRTPESTQIGQYGNGLKSGSMR
IGKDFILFTKKDDTMTCLFLSRTFHEEEGIDEVIVPLPTWNARTRLPITENMDKFSTEIELIYKYSPFKSEQQVMDQFKKISGEMGTLVIIFNLKLTDNGEPELDIVSDP
WDIQMAETSLEGTKPEHRSFRAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYTSNRFKTRAEQEVKKAEHVARIAEDKAREAENKARVLELRLGGDLTRESRV
ALRQVQGTAINLRREAGIKKCIREAKQRALKEPKELNFVFGVNIEQRHLDGMFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLVLEPTHNKQDFADAKEYRHLL
KAMGDHLTQYWKDVAIAQRGIIKFWDEFGYLSANWSQPPSKELRYKRRRAMEIPTTIQCDLCLKWRTLPFQLSSVERDYPDTWVCTMNPDAEQDSCNVSEQKQKVPLGIL
KKDLKTQEEKQKQLTEKIRQKQERLEALQKTIPIRSQADLKKLPLEVSCRPAMKDSHAVRRFSRPRSPPLPAEIKNSSSRPPPPKAPRSPFQARRGALAISPRLAHSPAP
EEASISRMSPAPLAPRKPSSTLVKPATRMVSVIVNARKRSFPAAEEETEEDGDRKKGKSKRSKGLVVKDEKKDSSDEDLAALKKSQKDKGRHVEVRVNGEWCTGRVTAVD
LSKHGLRWKVKFDYVPTDTTPRDRWVEKRSEDVRLMKPPSPESQSPDTQQQEDEDVMVTVEPSTSDCVPTEPDTTAPNSSQESVELLVQTLRNCLRYFLPPNFPISKKEL
NSMSPEELMTFPLKEYFRQYEMGLQNLCNSYQSRAKASEENLRASERKLRETEEKLQNLRTNIVALLQKMQEVSRDSSREHRSDPAFQSCPEHPLSDLT*
15 >lcl|XP_001374664.2|Plus127798871..27799257 NW_001581837 translationally-controlled tumor protein-like LOC100022984 __SEG__ Chr1 {Monodelphis domestica} MIIYPDLLSHEEVFSDSYKFLEIENRLCLEVEGKMVRKAEGAIDDSLIGGNASAEGPEGEETDATKMTGVGIVINHHLQETSFTKESYKKYIKDYMKSSKGRLKDQKPDR
VKPFLTGATEQINVNKFS*
16 >lcl|XP_001377178.1|Plus15323448..5324608 NW_001581846 cyclin-A2-like LOC100026636 __SEG__ Chr1 {Monodelphis domestica} MLGKLGKKIRAQVIAQALMKRKCQLLALLGVNGKQRAGPRRNATSQQSAFTVQMDEPCGEREKEFLSPKKVQCEDKRWDFNSAVSLPATSRPLVPCNQTMDVSFEASLSL
EVSVKLEAPPKLPNIMEVSDYAEDIYLYLREMEVKFKLNVDYMKNQPDTIDGLRVLILNCLVVAGQLLELQNETLHLAVKYFDRYLSLEPVSDETLYLLGIVALRLATKF
EEAYPLQIIQLIHHMDGQCTKKQISEMECRMLQVLAFDLALPTINQFLTQYFLHQQQPNPHVESLAMFLGELCLVDTVTYLKYLPSVTAGAAFHLALYTVTGKSWPESLV
QKTGYTLETLKPCLMDLHQTYLSASQHAVYSIPEKYSKPIYHSVAHIPPPETLNLE*
17 >lcl|XP_001377196.1|Plus1complement(5333276..5334661) NW_001581846 cyclin-A2-like LOC100026662 __SEG__ Chr1 {Monodelphis domestica} MFPYVFGHPLGLPGVYPTQPTVQTLAQNAVWGSWHGEMQGLAREELRPTATSSQENLETIHSDSFSNTSLFRKSRTLGVLQKKVRAQVMAQALMKRKCQLLAVLGVNGKQ
RAGPRRNATSQQSAFTVQMDEPCGEREKEFLSLKKVQCEDKRWDFNSAVSLPATSRPLVPCNQTMDVSFEASLPLETSMKLEAPRKLPNIMEVSDYAEDIYLYLREMEVK
FKLNVDYMKNQPDTIENLRVLLLNWLVVAGQLLELQNETLHLAVNYFDQYLSLEPVSPDMLQLLGIAALRLATKFEEAYPLRMIKLIHHMAGQYTKKQITGMECRMLQVL
AFHLALPTINQFLTQYFLHQQQPNPHVESLAMFLGELCLVDTVTYLKYLPSVTAGAAFHLALYTVTGKSWPESLVQKTGYTLETLKPCLMDLHWTYLSASQHAVYSIPEK
YRKPMYHGVAHIPPPETLNLE*
18 >lcl|XP_001377210.1|Plus1complement(5338778..5340163) NW_001581846 cyclin-A2-like LOC100026685 __SEG__ Chr1 {Monodelphis domestica} MFPYVFGHPLGLPGVYPTQPTVQTLAQNAVWGSWHGEMQGLAREELRPTATSSQENLETIHSDSFSNTSLFRKSRTLGVLQKKVRAQVMAQALMKRKCQLLAVLGVNGKQ
RAGPRRNATSQQSAFTVQMDEPCGEREKEFLSLKKVQCEDKRWDFNSAVSLPATSRPLVPCNQTMDVSFEASLPLEVSMKLEAPRKLPNIMEVSDYAEDIYLYLREMEVK
FKLNVDYMKNQPDTIENLRVLLLNWLVVEGQLLELQNETLHLAVNYFNRYLSLEPVSPETLQLLGIAALRLATKFEEAYPLRIIQLIHHRAGQYTKKQISEMECRMLQVL
AFHLALPTINQFLTQYFLHQQQPNPHVESLAMFLGELCLVDTVTYLKYLPSVTAGAAFHLALYTVTGKSWPESLVQKTGYTLETLKPCLMDLHWTYFSASQHAVYSIPEK
YRKPMYHGVAHIPPPETLNLE*
19 >lcl|XP_001377225.1|Plus15346272..5347432 NW_001581846 cyclin-A2-like LOC100026704 __SEG__ Chr1 {Monodelphis domestica} MLGKLGKKIRAQVIAQALMKRKCQLLALLRVNGKQRAGPRRNATSQQSAFTVQMDEPCGEREKEFLSPKKVQCEDKRWDFNSAVSLPATSRPLVPCNQTMDVSFEASLSL
EVSVKLEAPPKLPNIMEVSDYAEDIYLYLREMEVKFKLNMDYMKNQPDTIDGLRVLLLNCLVVAGQLLELQNETLHLAVNYFDRYLSLEPVSPETLQLLGIAALRLATKF
EEAYPLRIIQLIHHRAGQYTKKQITGMECRMLQVLAFHLALPTINQFLTQYFLHQQQPNPQVESLAMFLGELCLVDTVTYLKYLPSVTAGAAFHLALYTVTGKSWPESLV
QKTGYTLETLKPCLMDLHWTYLSASQHAVYSIPEKYRKPMYHSVALIPPPETLNLE*
20 >lcl|XP_001377493.2|Plus178334193..78335479 NW_001581900 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr3 {Monodelphis domestica} MSFTTRSSTYSTNYRSLGSVRAPSHRIRPASSAASVYAGAGGSGSRISTARSSSFRGSWGAGSMMGGLAGIGGVHGEKETMQDLNDRLASYLDRVRSLETENRKLEGKIR
EHLDKKGPRIREWGHYFRTIEELRAQIFANSVDNARIVLQIDNARLAADDFRVKYEAELAMRLSVEKDIHGLRKVIDDTNVTRLQLESEIEALKEELLFMKKNHEDEVKS
LQAQIAGSGLTVEVDSPKSQDLSKVMADIRAQYDALAQKNREELDKYWSQQIEESTVAINTRSEEVEAARNTVTELKRTVQSLEIDLDSLRNLKTSLEESLREVETRYAI
QMEQINTALLHLEAELGQTRTEGRRQAQEYEALLNIKDKLEAEINTYRNLLENGEDFNLVHALDGSSSSLQSIHKTSTRRTVDGKVVAETNDTKVLRR*
21 >lcl|XP_001377546.1|Plus1complement(63880860..63881924) NW_001581835 cell cycle control protein 50B-like LOC100027175 __SEG__ Chr1 {Monodelphis domestica} MAWSATSPGANQPDNTAFTQQRLPAWQPLLSAGITLPLFFCVGLAFIGLGLGLYYSSNGIKEIEYDYTGEPGIGNCTACARVGERVAPPHPNCTCQWCFSLPELFQGPVF
LYYELSNFYQNNRRYVVSRDDEQLSGLASALRHPANECAPYQRTPTGLPIAPCGAIANSLFNDSFKLLYQRQPNGPYDEVPLDRTGIAWWTDYHVKFHNPAPINGSLKLA
FHGTAKPPNWPRPVYDLSPDPNNTGFVNQDFVVWMRTAALPTFRKLYARIRHVNYSAGLPRGTYCVNITYNYPVLAFGGQKRIIFSSISWMGGKNPFLGIAYLTFGSLCI
ITGFVMLIVYIRYQDENGDGDEDE*
22 >lcl|XP_001377602.2|Plus1complement(8703316..8704572) NW_001581855 septin-8-like LOC100027259 __SEG__ Chr1 {Monodelphis domestica} MADLDSRGVRLLTLSGHVGFDSLPEQLVCRQLCQGFTFNIMCVGETGIGKSTLMNTLFNTDFDSQECSHFERCVRLRQCCYNLCECDVHLRLTIVEAQGFGDQMDKDVEP
IVNYVDAQFESYLQEELKVQRCLYDYLDTRVHVCLYFITPTGHSLKSLDLVTLKRLDSKVNIIPIIAKADTLTKCELLKFKNKIKNDLGRNGVRIYQFPTDDEAVAQINV
AMNAHLPFAVVGSMDEVCVNNKLVRAREYPWGVVQVDDDDHSDFGKLREMLIRVNMEDLREQTHRCHYELYRCCRLKEMGYQSSLREYKPSLSQGSECVEAMRKQLAEEL
CRKEREMKQMIVNRMKQKEVEVKEMERELQARLECLKRIYQEERQKVEEKRKQLEDEKIAFNQRKAACEAMMKAQAAHPPRGDREQNN*
23 >lcl|XP_001377710.1|Plus181079274..81079621 NW_001581900 baculoviral IAP repeat-containing protein 5-like LOC100027413 __SEG__ Chr3 {Monodelphis domestica} MSGISTFQNWPFMEDCTCTPEKMAEAGFIHCPSENEPDLAQYFFCSKELEGWEPEVMLEHKKHSSICDFIGIKKKIEYLALNEFLKLEKERAKNKIEKESSQKIISFEAG
NESME*
24 >lcl|XP_001378270.1|Plus1complement(11709734..11710174) NW_001581855 shadow of prion protein sprn __SEG__ Chr1 {Monodelphis domestica} MNWAAVTCWTLLLLAAFFCENVTSKGGRGGARGAARGRSRSSSSSSRMRMKSAPRYSSSGSAFRVAAAASAGAAAGAAAGAVAGAAGRRMSGEVGTSVNLERDLYYSNQT
GEGIYSYRWTSGTDRGGVEPNLSLCLTLGFFQLFHP*
25 >lcl|XP_001378755.1|Plus161857716..61859773 NW_001582021 crooked neck-like protein 1-like LOC100028830 __SEG__ Chr8 {Monodelphis domestica} MAASALTRKQWIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPHQKITDEEELNDYKLRKRKTFEDNIRKNRNVMSNWIKYAQWEERVKEVQRARSIYERALDV
DYRNITLWLKYAEMEMTNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGSRQIFERWMEWQPEEQAWHSYINFELRYQEVDRARCIHERFVHVHPHVKNWIK
YARFEEKHGYLACARRVYERAVEFFGDEHMDQHLYVAFAKFEEKQKEFERVRVIYKHALDRLSQQQAQELLKHYTTFEKKFGDRQAIEDIIVSKRRLQYEEQVKANPYNY
DTWFDYLRLVESDGEPNTVREVYERAIASVPPIPEKRYWKRYIYLWISYALYEELEAKDPERTRQVYQACLKLIPHKKFTFAKMWLLYAQFEIRQKNLPLARRTLGTSIG
KCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFAPENCTSWIKFAELETILGDMERARAIYELAISQPCLDMPEVLWKSYIDFEIQQEEYEKTRSLYRRLLQRTQHVKV
WISFAQFELCAGTEESLTQCRHIYEEANQRMRNCEEKEERLLLLKSWRNFEYEFGTESQKERVDKLMPEQVKKRRKVQAEDGSDAGWEEYHHYIFPEDAADQPNLKLLAM
AKRWKKEQQEKDATEQDPGRGREEE*
26 >lcl|XP_001379076.1|Plus1658358..659758 NW_001587036 fizzy-related protein homolog LOC100029292 __SEG__ ChrX {Monodelphis domestica} MSWSLTEYGSSRSSPGKHGDRFIPSRSAANWDLKFHRTQDSEKSLKEKWPSRQATSGNSPIYSALLDNELLGVGIERVQNVKGRGQRLPQPCSPEKEDLFVYSPSTEGWW
RPDAVRAASSHGMSSISSKSQALLASQKKTPKSISAKPFKILEAPELQDNFCLNLLDWSSLNIISVGLGTSVFLWHAATCQVVRVCDLSVEGDSVTSVCWSQRGILLAVG
TQKGFVHVWDVVAERRVCVLNKHSSRVSVLAWNADQISSGSRDKLILQRDLRTRAMQSRRCLQGHSGEVCGLEWSTNRRLLASSGKDNTVVLWTPASPKPVQQHTGHKAA
VKAIAWSPHQHGLLASGGCQADCAILFWNTLTNQILQSIHTGSQVGNLAWSRHTNELVSTHGSPENQIAIWKYPSLAQANKLTGHTCPVSHLTVSPDGQVIATGAADETL
RLWEVFNKTHPSRPSESTLDLFTRIR*
27 >lcl|XP_001380458.2|Plus19591537..9593303 NW_001581847 major centromere autoantigen B-like LOC100031122 __SEG__ Chr1 {Monodelphis domestica} MGPKRRQLTFREKSHIIQEVEKNPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKFGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVNGIILKEKALRIAEE
LGMEDFTASNGWLDRFRRRHGVMSRNGVTKSRSQPSAPAQPPPPPRAPAPVPAADGGGGGGSRRWREELLPSLAEGYASQDVFNATETSLWYNFLPDQAPALRGEARPSP
RRGTERLIVLLCANADGSEKLPPLVVGKLAKPRGSRAGLPCDYTANPKGGVTAQELAKYLKALDARMADESRRILLLANRPAAPALDTSDLRHVQVAFFPSDTLQPLERG
VVQQVKGHYRQALLLKAMAALEDHDRSRLQLGLTEALRFVAAAWDAVEPADIAACFREAGFGGGPGPDIDEAVKSEEEEEEEEEEEDDNEEEEEEEDQGEEEGEEEGEEG
EEGEEEEEEEESSSEGLEADDWSQGGGEAGGSFVAYGGQDEQGCPTVQLLEAGEDSESESDEEEEEEEDDDDDDDDDDEDDDDDDEVPVPSFGEAMAYFAMVKRYLTSFP
IDDRVQSHILHLEHDLVHVTRKNHARQTSRALAHQNLA*
28 >lcl|XP_001380912.1|Plus1complement(82620746..82621495) NW_001582021 cyclin-related protein FAM58A-like LOC100031726 __SEG__ Chr8 {Monodelphis domestica} MESKQSESSAKGEEVKKEGHLVSEAKVHFKVTRFIMEAGVKLGMQSIPIATACTIYHKFFCETKLDAYDPYLIAMSAIYLAGKVEEQHLRTRDIINVSHRYLNPKSEPLE
LDSWFWELRDSIVQCELLMLRVLHFRVSFQHPHKYLLHYLISLKNWMNRHSWERTPVSLVAWALLRDSYHGVLCLRYPAPHIAVAVLYLALQCYGVEVPADSEAEKPWWQ
VFSEDLTKPVIDNIVSDLIQIYTMDTEIP*
29 >lcl|XP_001381010.1|Plus1complement(139530065..139531366) NW_001581902 septin-10-like LOC100031849 __SEG__ Chr3 {Monodelphis domestica} MASSEVARHMVYQSLVGIKATCVTSQPCKEERITDEDPRSLTITGHVGFESLPDQLVNRTLQQGFCFNILCVGETGIGKSTLIDTLFNTNFDHCGSSHFHPNVRLKAQTY
ELQESNVRLKLTIVNTVGFGDQINKEDSYRPIVDYIDAQFEAYLQEELKVKRSLFNYRDSRIHVCLYFIAPTGHSLKALDLLTMKHLDSRVNIIPVIAKADTLSKCDLQK
FKLKLMNELVSNGIQFYQFPTDDETVAQLNSSMNGHLPFAVVGSTEEVKLGNKMVKARRYPWGIVQVENENHCDFVKLREMLICTNMEDLREQTHIRHYENYRRCKLEET
GFKEVCPEKKPLSVLESQEIKRYDSFCELQRKEEEMKQLFVKRVKEKEAILKEAERELQAKFEHLKRLHQEERIKLEERRRNLEEEISALGKRKAACELKASL*
30 >lcl|XP_001381056.1|Plus1138532374..138533123 NW_001581879 cyclin-related protein FAM58A-like LOC100031915 __SEG__ Chr2 {Monodelphis domestica} MESKQSESSAKGEEVKKEGHLVSEAKVHFKVTRFIMEAGVKLGMQSIPIATACTIYHKFFCETKLDAYDPYLIAMSAIYLAGKVEEQHLRTRDIINVSHRYLNPKSEPLE
LDSWFWELRDSIVQCELLMLRVLHFRVSFQHPHKYLLHYLISLKNWMNRHSWERTPVSLVAWALLRDSYHGVLCLRYPAPHIAVAVLYLALQCYGVEVPADSEAEKPWWQ
VFSEDLTKPVIDNIVSDLIQIYTMDTEIP*
31 >lcl|XP_001381359.1|Plus119919519..19921939 NW_001581866 cell division cycle 5-like protein-like LOC100032322 __SEG__ Chr2 {Monodelphis domestica} MPRVMIKGGLWRNTEDEVLKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWTREEEEKLLHLAKLMPTQWRTLAPIIGRTAAQCLQHYELLLDKAAQR
DGEEETEDDPRKLKPGEIDPNPESKPAKPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIDLQKRKRKRGIDYNAEIPLEKKPA
PGFYNTLEESYPTLDADFSQLRQEDLDGELRSKKESRARKRDQQYWKSKKEADLPSAILQPPGISGFTKKRSKLVLPAPQISEAELQRVVKVVQASEIARHTAEESGIVN
SVSSTLLSEYHVTNASIALRTPKVPEAQDGILKEAQNLLALTNIDTPLKGGLNTPLHESDFSGVTPQQQIIQTPNTVLFTPFRTPRGAEGSTLQVGMAPKPLVGPTPQRT
SLRDKLNINPEESLADYNDPSYGKQTERESQERLRLGFLGLPTPKNDFEIVLPENVKELEDLEIEETFAEDAADADARRQAIQDAEHAKEIKQMHTAVQKGLPRPSEVNE
AILRPLHGGPPLADLEKSEELIKKEKIIMLHYDLLHHPYGEHAGNKKGKPRGFGSNSTQHITYLELNPYENFSKDELDKAQDLLTQEMEVIKQGMCHGELSNEVYNQVWE
ECYSQILYLPRQRRYTRANLASKKDRIESLEKRLEINRGLMTTEAKRAAKMEKKMKILLGGYQSRGMGLRKDLNALWDQIEHAYLELRTLELLKKQEDSAILRRLECLKE
DVQRQQEREKVLQQRYAHLLLEKDFEAQMLQTSLFS*
32 >lcl|XP_001381370.1|Plus1complement(20050117..20052528) NW_001581866 cell division cycle 5-like protein-like LOC100032336 __SEG__ Chr2 {Monodelphis domestica} MPRIMIKGGLWRNTEDEVLKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWTREEEEKLLHLAKLMPTQWRTLAPIIGRTAAQCLQHYELLLDKAAQR
DGEEETEDDPRKLKPGEIDPNPESKPAKPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIDLQKRKRKRGIDYNAEIPLEKKPA
PGFYNTLEESYPTLDADFSQLRQEDLDGELRSKKESRARKKDQQYWKSKKEADLPSAILQPPGISGFTKKRSKLVLPAPQISEAELQRVVKVVQASEIARHTAEESGIVN
SVSSTLLSEYHVTNASIALRTPKVPEAQDGILKEAQNLLALTNVDTPLKGGLNTPLHESDFSGVTPQQQIIQTPNTVLFTPFRTPRGAEGSTLQVGMAPKPLVGPTPQRT
SLRDKLNINPEESLADYNDPSYGKQMERESQERLRLGFLGLPTPKNDFEIVLPENVKELEDLEIEETFAEDAADADARRQAIQDAEHAKEIKQMHTAVQKGLPRPSEVNE
AILRPLHGGPPLADLEKSEELIKKEKIIMLHYDLLHHPYGEHAGNKKGKPRGFGSNSTQHITYLELNPYENFSKDELDKAQDLLTQEMEVIKQGMCHGELSNEVYNQVWE
ECYSQILYLPRQHRYTRANLASKKDRIESLEKRIEINRGLMTTEAKRAAKMEKKMKILLGGYQSRGMGLRKDLNALWDQIEHAYLELRTLELLKKQEDSAILRRLECLKE
DVQRQQEREKVLQQRYAHLLLEKDFEAQMLQTL*
33 >lcl|XP_001381563.2|Plus1complement(164246459..164247508) NW_001581879 proline-rich protein 18-like LOC100032587 __SEG__ Chr2 {Monodelphis domestica} MPFPPIQQQQPQQQQQQQQQQQVPGVPTPPTVNAAATRELPKKPTTQRKTAVHAPPVPGSLAPTAGGEKKKRPPEKAEMLLSSSWPSATLKRQLAKRTPGPAASRTQPQP
PLRPTQQPLAPATATTSTPTRPLLPATCTMPGLAHSCESLAAGGSSVPGPGAGTSSGGEEEAVRFSLSLTPEAILVIQRRNLEKQLLARQRRPFPSPAADTKRLLSSCPR
SKAGAMGTTSGQRKGIAISGAGGTPVGGFGSTSRRPTQSQPQLLSGAMQPLSTTSRGGHLGSGDLRTLLKISLLNEHHKYDDVEYEEEAEAVDEGLVRKCTEWLRGVENA
AATRDRAEKLETLPHLGTL*
34 >lcl|XP_001381773.1|Plus1complement(175890699..175892411) NW_001581902 jerky protein JRK __SEG__ Chr3 {Monodelphis domestica} MASKQPIVKNKGEKRKRVVLTLKEKIDICTRLEKGENRKALMQEYNVGMSTLYDIKAHKGQLLRFFANSDSNKALEHRRTLHTPKLEHLDRVLYEWFLVKRSEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDVSNERQSADHQAAEQFCGFFRSLIAEHGLSPEQFYNADETGLFWRCLPNSTPEGASASSLKQTKDRLTVLM
CANAAGSHKIKPLVIGKCNGPRTFKGIQHLPVAYKAQGNAWMDKEIFSDWFHHIFVPSVKDHFRNIGLPDDSKAILLLDNSRAHPQEAELVSDNIFTIFLPASVTSLIQP
MDQGIRRDFMRNFINPPVTVQDLQTRYNISDAIFNVACAWNSVTSEILRRAWRKLWPSVMFAEVSSDEEEFDRFRVRPPNNTLVQILEMVKDPPSPPVNKLNKNEGNKWA
DADQEGEVSQGVSDTEIVETVWNPDNGTDSEKDSDGEDFREGEKTSWEKAASSFDSIISFAEKQPCFTNQEIMQLHMLHAIFMRQRQMANKQTEIRDIVKTENPRGYPGV
CTDSAQSPIPSTSTALYSDN*
35 >lcl|XP_003339582.1|Plus1complement(51106063..51107634) NW_001581837 tigger transposable element-derived protein 6-like LOC100619610 __SEG__ Chr1 {Monodelphis domestica} MANKGNKKRRQFSLEEKMKVVEAVDSGKRKGDVAKEFGITPSTLSTFLKDRAKFEEKVREASVGPQRKRMRNALYDDIDKAVFAWFQEVHAKNILVSGSVIRKKALNLAN
MLGYDNFQASVGWLNRFRDRHGIALKAICREDNDKLMNGIGIDKVNEWHAGEIIKLIADYSPDDIFNADETGMFFQLLPQHTLTAKGDCCRGGKKARQRLTALFCCNASG
TEKMKPLIVGKSATPRCFKNVHSLPCDYRANQRAWMTRDLFNEWLMKVDAKMKQAERRILMLIDNCSAHNMLPRLERIQVGYLPSNCTAVLQPLNLGVIQTMKVLYRSRL
LKQIVLNLNNNEEKEKINIKQAIDMIAGAWWSVKQSTVVKCWQKAGIIPMEFTDTEPEDDDEPDIAIEKLWNSVAIATCVPNEITFQDFVTADNDLLISCELTDVEIVES
MMTGTRPEESESEDDEGVSFLEQPKLTIAEAISSVEKLRQFLSTCTDVPEAVFGQLNGIDEYLMTSVTHTLVESKITDFLQAK*
36 >lcl|XP_003339654.1|Plus1complement(25486915..25487433) NW_001581839 translationally-controlled tumor protein-like LOC100017156 __SEG__ Chr1 {Monodelphis domestica} MIIYRDLISHDEMFSDIYKIREIANGLCLEVEGKMVSRTEGTIDDSLIGGNASAEGPEGEGTDATVITGVDIVINHHLQETSFTKESYKKYIKDYMKSIKGRLEEQKPDR
VKPFMTGATEQIKHILANFNNYQFFIGENMNPDGMVALLDFREDGVTPYMIFFKDGLEMEKC*
37 >lcl|XP_003340764.1|Plus1complement(8636542..8638557) NW_001581903 tigger transposable element-derived protein 5-like LOC100619342 __SEG__ Chr3 {Monodelphis domestica} MYPSGPPGPAPHPRRRRPLAPSRPGPPLLPQAVGEEEPPPQASGRGPLPAVPAAPPGSGGSPGAPGLAVKMAFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLR
GWLKDEPKLRWFLDQLGGEVGTQRKKMRLANEEEIDRAVYTWFLTLRQHGIPLSGPIIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPPPPPPAS
APSLPTVKTEPDLVGMGDHPSPMQPPTPTDGGYGDEQIYNANVTGLYWKLLPEQAAPPGEGDPGSGGRRWRGDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDK
FPASYRYSPDAWLSATLLRGWFFEEFVPGVRRYLRRSCLQQKAVLLVNHHPGPRPQGPRPPSPEESEEAGEQPRAAGGLGPGPALCHPEELQTPDGAVRVLFLSKSSARG
KIPAPLEQGVVSAFKQLYKRELLRLAVSCAGGSPLDFVRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPDDEEQLVQPHPGASGEDEEAEEHSKVLSDLTH
LAALTYKRLAPEDVAEWLHLDDGAPGLGEPPEGGGEEDEDGGGREYPPCGGFPPLAGPPQGEEDSGTGGSSPVPTAGEAIKGLETALRWLESRDPREVGPLKLVQLRSLI
SMAQRLGETGP*
38 >lcl|XP_003341267.1|Plus1complement(129640645..129641163) NW_001581961 translationally-controlled tumor protein-like LOC100026304 __SEG__ Chr4 {Monodelphis domestica} MIIYRDLISHGEMFSDIYKIWEIANGLCLEVEGKMVSRTEGTIDDSLIGGNASAEGPEGEGTHATVITGVDIVINHHLQETSFTKESYKKYIKVYMKSIKGRLEEQKPNR
VKSFMTGATEQIKHILANFNNYQFFIGKNMNPDGMVALLDFHEDGVTPYVIFFKDGLEMEKC*
39 >lcl|XP_003341417.1|Plus1complement(20940123..20941709) NW_001581965 tigger transposable element-derived protein 2-like LOC100618011 __SEG__ Chr5 {Monodelphis domestica} MSGKRKRVVLTIKDKLDIIKKLEEGSSFKRLSVVYGIGESTVRDIKKNKERIITYANSSDPTSGVSKRKSMKSSTYEELDRVMIEWFNQQRNEGIPVSGTICAKQAKFFF
DALGMEGDFNASSGWLTRFKQRHGIPKVAGQGTKLNGDETAASEFCCKFREFVEKENLQPEQIYSADQTGLFWKCLPSRTLAFETEHSTSGYRSSRERIIVMCCANATGL
HKLNLCVVGKAKKPRSFKGTEPSNLPVSYFSQKGAWIEHPVFRQWFVKNFVPQVRKNLKSKGLLEKAVLLLDFPPAHPDEEILSSDDGKIFVKYLPANVTALIQPMCQGI
LATVKRYYRAGLLQKYMDEGIDLKMFWKNLTVLDAIYEVSRAWNMIKSVTITRAWNKLFPGIEENIGLNFDEGAILAANLATVLQHTEGCENVDIENIEDWFEAENTEPN
YDVLTDSEGTQGQIDQSDHSSENEEVEETELISQRHISHKSALEWTENLLDYLEQQDDMLLSDKLVLRRLRTTIRKKQKTQNNNKSQQ*
40 >lcl|XP_003342099.1|Plus1complement(10003289..10004392) NW_001582021 GTPase IMAP family member 4-like LOC100616953 __SEG__ Chr8 {Monodelphis domestica} MSEQGFITINHKTWSFILLSCLFSTDPNHRRRCSKGPEVRIVLVGKTGAGKSETGNTILGRREFESKCSGGSVTKVCRKAWTSRNGRSISVVDTPGIFETDATEEETMLE
IVRFITLSSPGPHAILLVLKVDRFTSEEKEAIERIFKILGEEAVKFLIILFTGKDRLEEQSIGEFIGTIQDPYFKELLKKCEYRYHAFDNKANEAQKVTQVSELMTMILN
MVQYNGNTHYTNKSYESVEEFIQKGTEISQQHYKEQFEKKMKEIRQKYEEEIKKLEKKRKELEKKMENQAIEIKEYKKEKEEYEKQKLNLIDKKNKESKEEEAKYKRDYL
GARAEVENSQSTLLEVMKFILPFAITCLVRVFLKKIF*