SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab D    

ID / Description / Sequence
1 >lcl|NP_001229383.1|Plus127974113..27975687 NW_001867377 hypothetical protein LOC100071686 TIGD14 __SEG__ Chr14 {Equus caballus} MANKGNKKRRQFSLEEKMKVVEAVDSGKRKGDVAKEFGITPSTLSTFLKDRVKFEEKVREATVGPQRKRMRNALYDDIDKAVFAWFQEIHAKNILVTGSVIRKKALNLAN
MLGYNNFQASVGWLNRFRDRHGIALKAVCREDSDRLMNGLGIDKVNEWHAGEIIKLIADYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRLTALFCCNASG
TEKMRPLIVGRSANPRCLKNVHSLPCDYRANQWAWMTQDLFNEWLIQVDTRMKQAERRILLLIDNCSAHNMLPRLERIQVGYLPSNCTAVLQPLNLGIIHTMKVLYRSHL
LKQILLKLNSNEDQGKVDIKQAIDMIAAAWWSVKQSTVVKCWQKAGIIPMELTDSNTEAAAIEPDIAIEKLWHSVAIATCVPNEINFQDFVTADDDLIISQELMDTEVIQ
GMVASENTDEAGSEDEGEASLPQQPKITITEAISSAQKLRRFLSTCVGVPDAIFGQLNGIDEYLMRRVTQTLVDSKITDFLQTK*
2 >lcl|XP_001492224.1|Plus110989885..10990403 NW_001867430 centrin-1-like LOC100060854 __SEG__ Chr8 {Equus caballus} MASSFKKTNSASTSQKRKVGPKPELTEDQKQEVREAFDLFDANGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEGTGKISFNDFLAVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNQEEFLRIMKKTNLY*
3 >lcl|XP_001496869.1|Plus1complement(40620722..40622332) NW_001867435 jerky protein JRK __SEG__ Chr9 {Equus caballus} MASKQAAGRSPGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIKAHKAQLLRFFANSDSNKALEHRRTLHTPKLEHLDRVLYEWFLVKRAEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASSEKQMADHQAAEQFCGFFRSLTAEHGLSPEQVYNADETGLFWRCLPNPTLEGGAAPSTKQNKDRLTVLM
CANATGSHKIKPLVIGKGSGPRAFRGIQHLPVAYKAQGNAWVDREIFSDWFRHIFAPSVKEHFRTLGLPEDSKAILLLDGSRAHPQESELVSDNIFTIFLPAGVTSLIQP
MDQGIRRDFMRHFINPPLTLQGFQPRYNVNDAIVNVACAWNAVPSDVFGRAWGKLWPTGTLAEGSSSEEEPERLRTKPHAQTFAHVLEPGSRLPRGAAAAQGGPAQVAGE
GRPAVAGPALAVGSPEQAEEEGEEAAWEQAAVSFDALVRFAERQPCFTAQEAGQLRALRSVFVRQRQEKRRPPAPGAMVKLEVPQDMACSSTAGKN*
4 >lcl|XP_001500351.1|Plus1complement(18897048..18898457) NW_001877044 nucleosome assembly protein 1-like 3 NAP1L3 __SEG__ ChrX {Equus caballus} MAEADLKVVSEPAAQGFAEEMMANSSSDTGEESDSSSSSRSTSGSSSSRGRLYRKKRVSGPSRRVRRAPSGKNFLDRLPPAVRDRVQALRNIQDECDKVDAQFLKAIHDL
ERKYAELSKPLYDRRFQIINAEYEPTEEECEWNSEDEVFSSDEEVQEDSPSEMPALEGEEEDDPQEKPEETPGENEVPNDIPEAKTEEKAESKDFLEGKPGVKEDPKEVP
QAMSGSKEQPKATEAKARTGVKEAPKRVPEVRPQERVNLKRARKGKPKNEDPKGIPDYWLTVLKNVDKLGPMIQKYDEPILKFLSDVSLKFSKPGQPISYTFEFCFLPNP
YFRDEVLTKTYIIKSKPDHDDPFFSWGWEIQDCKGCKIDWRRGKDVTVTTTQSHRAATGEIEMQPRVVSTASFFNFFSPPEIPQIGKLEPREDAILDEDFEIGQILHDNV
ILKSVYYYTGEVNGTYVDGKHYRNRKYRK*
5 >lcl|XP_001501667.2|Plus1complement(38855523..38856446) NW_001867366 cyclin-dependent kinase 5 activator 1-like LOC100071764 __SEG__ Chr11 {Equus caballus} MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSLISVLPWKRIVAVSAKKKNSKKVQPNSSYQSNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPP
ASQLSGSQTGVSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDH
ELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR*
6 >lcl|XP_001504809.1|Plus1complement(49000371..49000799) NW_001867366 baculoviral IAP repeat-containing protein 5-like LOC100061505 __SEG__ Chr11 {Equus caballus} MGAPLLPPAWQLSLKDHRVSTFKNWPFLEGCACTPEWMAVAGSIHCPTENEPNFAQGFFCFKELQGWEPDEDPVEEHEKHSSGCAFLSVKKRFEELTLSEFLKLDKERAK
NKVAKETNSNQKEFEETAKKVHYAIEQLAALE*
7 >lcl|XP_001505016.1|Plus1complement(253934..255289) NW_001877044 nucleosome assembly protein 1-like 2-like LOC100059481 __SEG__ ChrX {Equus caballus} MAESADYKELLESSQEEAGNKVMMEGPREQPERGEEAAAGPGEEGERGEDAAAGSGEGGEKGEDTDEDSDPDRPKGLTGYLLDTDFVESLPVKVKYRVLALKKLQTRVAN
LESKFLREFHDIERKFAELYQPLLEKRRQIINAIYEPTKEECAYKSDSEDYDEEEMYDEEEMYGNEESLVHEYMDEGDGYEEDYYDYDVEEEEDDEDDDDDDDDDIEATR
EENKEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSRLAFYDPHPYRGTAIEYCTGCEIDWNEGK
NVTLKTIKKKQKHRIWGTIRTVTEDFPKDSFFNFFTPHGISSNGKDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWMAAIEEVKACCK
NLETIVEDIDR*
8 >lcl|XP_003364127.1|Plus1complement(4193433..4194278) NW_001867395 microtubule-associated protein RP/EB family member 3-like LOC100050599 __SEG__ Chr24 {Equus caballus} MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQW
FKKFFDANYDGKDYNPLLARQGQDIAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLLDLKLTVDGLE
KERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY*