SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam D    

ID / Description / Sequence
1 >lcl|XP_003431949.1|Plus1complement(26483333..26483674) NW_876258 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1-like LOC100683731 __SEG__ Chr14 {Canis lupus familiaris} MSTLVVWVILRFLEEYLSSTPQRLKLLDTYLLYILLTGALHFGYCLPVGTFPFNSFVSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMN
FVG*
2 >lcl|XP_003432296.1|Plus1complement(845482..845829) NW_876264 cyclin-dependent kinase 2-associated protein 1 CDK2AP1 __SEG__ Chr17 {Canis lupus familiaris} MSYKPNLAAHMPAASLSAAGSVHPPSTSMATSSQYRQLLSDYRPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSPMERLKRGIIHARGLVRECLAETE
RKARS*
3 >lcl|XP_003432600.1|Plus15351151..5351957 NW_876269 microtubule-associated protein RP/EB family member 1 MAPRE1 __SEG__ Chr1 {Canis lupus familiaris} MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFEILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
FKKFFDANYDGKDYDPVAARQGQETAVAPSLVVPALNKPKKPLSSSSAAPQRPIATHRTTATPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGK
LRNIELICQENEGENNPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY*
4 >lcl|XP_003433832.1|Plus1complement(7481342..7481632) NW_876292 dynein light chain roadblock-type 1-like LOC608447 __SEG__ Chr2 {Canis lupus familiaris} MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKAWSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE*
5 >lcl|XP_003434915.1|Plus120231762..20233408 NW_876321 tigger transposable element-derived protein 7-like isoform 1 LOC100683507 __SEG__ Chr6 {Canis lupus familiaris} MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFRISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRKRTTGAKYGDVDDAVYMWYQQKRSAGIPVRGVELQAAAERF
AQCFGRTDFKASTGWLFRFRNRHAIGNQKVCGEQALSSASENVEPFRQNLYMLIKEEKLSVAQLYSGDETDLFWKSMPENIQASRKEICLPGRKINKERLSALLCANADG
THKLKSIVIGKSKLPKSVKEDTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHFQLNVLGFHEEDVRAMLLLDSSPVHPSTESLSSEDGRIKCMFFPHNTSTLIQPM
HQGVILSCKRLYRWKQLEESLVIFEESDDEQDRGEKGVSKIKIYNIKSAVFNWAKSWDEVKQITIANAWGNLLYKKEPEYDLQGLEDGDYREILEKCGELENTLADDRVW
INGDDEEKGSSPKPKSGITKEVIQKGGGDEEQTAEFQLSAVRERLDYLLDFVDATPEFQRFHFTLKEMQQEIIKKQFQNRIHSRIGSFLKPRPCIVKDSFNMPSTSSN*
6 >lcl|XP_003435347.1|Plus1complement(22317742..22318665) NW_876332 cyclin-dependent kinase 5 activator 1 CDK5R1 __SEG__ Chr9 {Canis lupus familiaris} MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPP
ASQLSGSQTGVSSSVKKAPHPALTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDH
ELQAILLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR*
7 >lcl|XP_533170.2|Plus112407700..12408485 NW_876266 microtubule-associated protein RP/EB family member 1-like LOC475961 __SEG__ Chr18 {Canis lupus familiaris} MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMSVDKIIPVDKLVKGKFQDHFEFFQW
FKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLSSSSAAPQRPIATHRTTATPKAGPGEVRKNPDVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGK
LRNIELICQENERENNLVLQRIVDILYATDEGGPQEEQEEY*
8 >lcl|XP_533970.1|Plus1complement(4782443..4784017) NW_876273 jerky protein homolog-like JRKL __SEG__ Chr21 {Canis lupus familiaris} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPVSGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRTSAIKGKYSVSGHKAVEERVTIMCCANATGL
HKLKLCVVGKAKKPRSFKSTDTSNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGV
VATMKRNYRAGLLQNNLEEGNDLKSFWKKLTLLDALYEIAMAWNLVKPATISRAWKKILPTIEEKEGLDFDEEDISMATVSTILQHTKGLENVTTENIEKWLEVDSTEPG
YEVLTDSEIIRRAQGQTDESSENEEEEIELIPEKHINHAAALQWTENLLDYLEQQGDMILPDKLVIRKLRATIRNKQKMTTSSQ*
9 >lcl|XP_534382.2|Plus1complement(674767..675573) NW_876317 microtubule-associated protein RP/EB family member 1-like LOC606844 __SEG__ Chr6 {Canis lupus familiaris} MAVNVYSTFVTSDNLSRRDMLAWINESLQLNLTKIAQLCSGAAYCRFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMNVDKIIPVDKLVKGKFQDNFEFVQW
FKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLSSSSAAPQRPIATHRTTATPKAGSGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLDKERDFYFGK
LRNIELICQENEGENNPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY*
10 >lcl|XP_536672.3|Plus113066412..13067329 NW_876313 serine/threonine-protein phosphatase 6 catalytic subunit PPP6C __SEG__ Chr5 {Canis lupus familiaris} MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLL
RGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPGGAGWLFGAKV
TNEFVHINNLKLICRAHQQVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLVRAVPDSERVIPPRTTTPYFL*
11 >lcl|XP_539188.1|Plus1complement(7099717..7101342) NW_876256 jerky protein JRK __SEG__ Chr13 {Canis lupus familiaris} MASKQAAGRSPGEKRKRVVLTLKEKIDICTRLEKGESRKVLMQEYNVGMSTLYDIKAHKAQLLRFFANSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRAEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASGERQGADHRAAEQFCGFFRSLTAEHGLSPEQVYNADETGLFWRCLPNPGLEGGPAPGVRQNKDRLTVLM
CANATGSHKIKPLVIGKCGAPRAFGGIQHLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVKEHFRVAGLPEDGKAILLLDHARARPREAELVSGNIFTIFLPASVTSLIQP
MDQGIRRDFMRHFLNPPGLLQGCHPRYSTNDAVFNVACAWSAVPGHIFSRAWKKLWPAVTFAEGSSSDEEPDGLQVKPHNQTFAHILELGREAPGCPSSRLHRGTATEQS
GPGCAAGEDPAPAVGSLELAEKDGDEAAWEQAAASFDAVVRFAEGQPCFTAQEVGQLRTLRSVFVRQRQVKRRRVALRAVVKLETPPEASPLPCSSTAGEH*
12 >lcl|XP_543152.2|Plus111661245..11661535 NW_876278 dynein light chain roadblock-type 1-like LOC486026 __SEG__ Chr25 {Canis lupus familiaris} MAEVEETLKRLQSQKRVQVIMVVNTEGIPIKSTMDNPTTTQYANLMHNFILKAWSTVREIDPQNDLTFLQIRSKKNEIMIAPDKNYFLIVIQDPTE*
13 >lcl|XP_547653.1|Plus13620438..3620956 NW_876324 centrin-1 CETN1 __SEG__ Chr7 {Canis lupus familiaris} MASGFKKSNVASTSQKRKVGPKPELTEDQKQEVREAFDLFDADGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEGTGKISFNDFLGVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVAVELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTNLY*
14 >lcl|XP_548400.2|Plus13439217..3442765 NW_876333 protein KIAA0649-like LOC491279 __SEG__ Chr9 {Canis lupus familiaris} MFLMNAPPVVALQSKWEAFGTPGSFRFPGCFSEPKEGVSRASVSAKVQMVISTLQSDKAALGMSDELALQRSQRAEKGRDTRLAANPAFAACGLAADFVPSREEQAADFG
PLVLDSDSDDSVDRDIEEAIQEYLKAKSGATQPPGATDGGRRSKLEVRLSSTPTAPCPLKLPPSSGGAPGSRVGAGQDRGSASPVSVSSDDSFEQSIQAEIEQFLNEKRQ
HETPRCDVSMDMKPDPSNNAARLAFRSSKEPTAKAHRQDVMGTYKDFVFRKPPRLAKVSTRPRGLGSRATIEPESVDGAKPAATASHPAEAAPSKGVVRRSVGPGRRAKR
AKSTALVCKASGSSSDDGIEEAIQLYQLEKRKEAGGDLPQRTPLGEGKGPEPPAHSTGHSTKSAFPETHRKTPGRKKPVAPKAVDLSPGGPDPDHPSKPPKDPRATENEL
LERPPCRADTSAELMCAEAILDISKTILPAPMGGSERPPPASSLSYPLIVPSRCDGDSSSVDSSDSIEQEIRTFLALKAQSGAWLARTESCPPSTQSPAPPPGPRVPGSK
TLGLSLSCKRKRRGGSHAVPPSTPKKAREAVQEAARDVDHGPASTQPGQAPRVEGQSRGQPIPCKPLELSDQQGAPDARGSTWPSRGKAAPARSTGERGSSEDKSSSLDS
DEDLDTAIKDLLRSRRRLKKRWKDPRAACKRKVRFSTTEPQFLDKLGSFRKDWKDRSPHLLKSCLSKPKRDGRENLGKKPLSVSCRDTERSRVDGPRDAAPALQLRRKVS
EGNLFCPEVDACEPLATAPSSQPPPDDSSSVDSDDSIELEIRKFLAEKAKESGSGSEAPGGGPAALGMGSVPRPELPCRKVPPPALALQPGVCTRSQRGRGSLQPARGLG
GTGRAFLPGGRSGPRAEQACLPAAVARHTSGAGALSAKGSAAGRRLVCTHKDQSSRGTECARQRALGPLPTQIEAGAQAESPGVAFAATTQGQGPRTRKLGADGPGSPQA
GLALPWADFAHQSRLQSTWALSPEGREATWRGGLGGQRDHGPEGQDPKKSLPFTGFSSLLSTQLFHFGKSVSWGGRQASVFSPPLSLPLQGPSFSAFRETPAGHSPVFGS
SHLLTKKEGGHWPARKSQVACALPTRRNSGSEEDVLDLRYRRRVISGGDEAREALGSDSSELSDTSMEEGGGPETQGKALQP*
15 >lcl|XP_549079.2|Plus1complement(8470279..8471667) NW_879563 nucleosome assembly protein 1-like 2 NAP1L2 __SEG__ ChrX {Canis lupus familiaris} MAESADHKKLLEFSQEEADNKVIMEGPGEQPEQSEDVAAGPGDDKERGEEAAVGPGKEGGKGEDAAAGSGEGGVKDEDIDEDSDRPKGLIGYLLDTDFVESLPLKVKYRV
LALKKLQTRVANLESKFMREFHGIERKFAEMYQPLLEKRRQIINAIYEPTKEECEYKSDSEDYDDEMYDEEEMYGNEEGLVHEYMDEDDGYEGDYYDYAVEEDDGDDDDD
DNGDDIEATGKENKEEQDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSGPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSRLAYYDPHPYRGTAIEYC
TGCEIDWNEGKNVTLKTIRKKQKHRIWGTVRTVTEDFPKDSFFNFFTPQGISSNGKDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWM
AAIEEVKACCKNLETIVEDIDR*
16 >lcl|XP_549123.3|Plus1complement(20622882..20624303) NW_879563 nucleosome assembly protein 1-like 3 NAP1L3 __SEG__ ChrX {Canis lupus familiaris} MAEEDLNMVSEPAAQRVTEEKMASSSSDSGEESDSNSSSSSTSCSSSSGSGRSRLYRKKRVSGPSRGARGAPLGKSFVDRLPQAVRNRVQALRNIQDECDKVDILFLKAI
HDLERKYAELNKPLYDRRFQIINAEYEPTEEEYEWNSEDEVFSSDEEVQEDSPIEMPALESEQEDDNPKEKPQVKAEENEVPKEIPEAKTEENAESKDFLGIKPEVKEEP
EVVPQQNAEDQKQPKAAEAKAKAAVIEAPKRISEVRPKERVNLKRARKGKPKKEDPKGIPDYWLTVLKNVDKLGPMIQKYDAPILKFLSDISLKFSKPGQPISYTFEFYF
LPNPYFRNEMLTKTYIIKSKPDHNDPFFSWGWEIQDCKGCKIDWRRGKDVTVTTTQSRTTASGEIEIQPRVVANASFFNFFSPPEIPKIGKLEPREDAILDEDFEIGQIL
HDNVILKSIYYYTGEVKGTYDDGKDYGNRKYRK*
17 >lcl|XP_850123.1|Plus1complement(11918042..11918578) NW_876297 nucleosome assembly protein 1-like 5 NAP1L5 __SEG__ Chr32 {Canis lupus familiaris} MADSENQGPAEPSQAAAEAAEEVMAEGGAQGGDSDSAAGPTAEEPQTPADNAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKI
QELTGEMEGCAWTLEGEEDDDDEEEYEDEEEGEEEEEEEEEAAAEAAVEAAAAKDEGPHSAVPDDAKK*
18 >lcl|XP_850143.1|Plus11342285..1342683 NW_876327 G patch domain-containing protein 4-like LOC608133 __SEG__ Chr8 {Canis lupus familiaris} MSATPEIKSHGMKFAEEQLLKHGRTQGKGLGRNENGITQALRVTLKQDTHGVGHDPAKEFTDHWWDELFNRTAASLVVEAGQDGVRIKRLSKETGRRNHPKPNLLYQKFV
KLWSQAGRSGLQTGPESGASDS*
19 >lcl|XP_851406.2|Plus117567080..17568897 NW_876277 LOW QUALITY PROTEIN: major centromere autoantigen B CENPB __SEG__ Chr24 {Canis lupus familiaris} MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEE
LGMDDFTASNGWLDRFRRRHGVVSCSGVARARSRSAAPRPPAAPASPPAVPSEGGGGGSTGWRAREEQPPSVAEGYASQDVFSAIETSLWYDFLPDQAAGLCGSDGRARR
ATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQAGLPCEYTANSKGGVPPRPNQVPEGPGHSHGCGVSPGPAAGWPSGCPVPGYLGPAARTAGFLPSGHRAAAGAGSGP
TGEGPLPPGYAPQGHGRTRGPGSLGPAARFDGGPALCGCCLAGSGAFGHSCLLP*GWLRGWPKCHHHHCPQE*GGGRGGGGRGGRRRGGRGGGG*RGGGGGGRRRRGGGR
GGRRGVGGGRGGGRGG*C**Q**RGGGRGGRELL*GVGGRGLGPGGSGSRWQLWGLRCPGGGPVPNPPFPGG*RGLRV*Q*GRGGRGGG*GG*R**R*GGGW**GACS*L
WGGHGLLCYGQEVPYFLPHRRPSAEPHPSLGTRSGPRDQKEPRQTGGSSGSWTSEL
20 >lcl|XP_852075.2|Plus137737530..37738342 NW_876263 microtubule-associated protein RP/EB family member 1-like isoform 1 LOC609553 __SEG__ Chr17 {Canis lupus familiaris} MAVNVYSTSVTSENRSRHDMLAWINESLRLNLTKLEQLCSGAAYCQFMDILFPGCIALKKVKFRAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
FRKFFDANYDGTDYDPVAARRGQETAVAPSLVTPALNKLKKPLSPSQSAPQRPTGTHRTTTTLKAGQCGVQKNPVVGMGKGDGQVAVLIQQVNVLKLTIKDLEKERDFYF
GKLRNIDLICQENEGENNLVLQRIVDILYATHQGFVIPAEGGPQEEQEEY*
21 >lcl|XP_853120.2|Plus125528665..25529777 NW_876304 cyclin-dependent kinase 5 activator 2 CDK5R2 __SEG__ Chr37 {Canis lupus familiaris} MGTVLSLSPASSAKGRRPGGLPEEKKKAPPVGDEALGGYGAPPAGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRD
PPDGGGATKPLAVPVPTVPAAAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAQQAAPPVPGGSPRRVIMQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSL
LLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGE
AAAGAGGPPSGGAPAAPAAASAARDSCATGAKHWTMNLDR*
22 >lcl|XP_853792.2|Plus121365692..21366021 NW_876323 prothymosin alpha-like LOC611067 __SEG__ Chr7 {Canis lupus familiaris} MSEASVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVEEGGEEEEEEEEEEEGDGEEEDGDEDEEAEAGTGKRAAEDDENDNINPKKQKTDEDD*
23 >lcl|XP_854539.1|Plus129362268..29364613 NW_876332 serine/threonine-protein kinase haspin GSG2 __SEG__ Chr9 {Canis lupus familiaris} MAASAPLPGNRLFRTYGNVGGGRPRRGPDRAAAQWFPPQDRKRFFSSSSSSDASSGGPSGSVASDDPDDPDFLGLPAGRRRRRPGGRASRDRPSLIATPRRLRLRARPPQ
KCSTPCGPLGPPPFPSDDPGRPSPDLSACGQPGDGGELGTSASLFSSPVSPGPGPPAPGDSVLCTGPSASLDVASEVPGGLHLPAASLDTPPLHGFQEAAGGGRFTRLAH
QARASLRSALFNIMDCGNSEDSEFGADGRNMRGSCCEKEQTRGSLERPGLSHMGKKRATGHDSCQEVRSPGAAQMDCEEADGFGSCIVSGETNRPERTRPRRKRKLEETV
ETSLIHCHQFKSQKMEKDSFLTQDLTHLQNSCSWTKARASFSLHKKKMVTAVSEVCSSHTIASSLSGSLISECLSPPVMIRTNSALSPWHCSSMYLLTPLKTLHVTDKKA
SDAAKVYGECSQEGPVPFSYCLSTEKLECCQKIGEGVFGEVFQTIVNHTPVALKIIAIEGPDLVNGAHQKTFEEILPEIIISKELSLLSDEVYNRTEGFIGLNSVHCVQG
SYPPLLLRAWDHYNSTKGSANDRPDFFEENQLFIVLEFEFGGTELEQMRTKLSSMATAKSILHQITASLAVAEASLHFEHRDLHWGNVLLKKTSVKELRYTLNGKTSTIP
THGLQVNIIDYTLSRLERDGIVVFCDISMDEDLFTGEGDYQFEIYRLMRKENNNCWGEYHPYNNVLWLHYLTDKILKQMTFKIKCNTPAMKQMKRKIQHFYRTMLNFSSA
TDLLYQHSLFK*
24 >lcl|XP_863247.2|Plus1complement(30184935..30186212) NW_876273 G2/mitotic-specific cyclin-B1-like isoform 3 LOC485338 __SEG__ Chr21 {Canis lupus familiaris} MALRVTRNTKVNVENKAKIGMAGAKRVPLASAAASKPGLRPRTALGDIGNKVSEQPQAKLPLKKEAKTAVPGKVIAKKIPKPLEKAPEPVPVPEPELEPEPVKEEKLSPE
PILVDTPSPSPMETSGCAPAEEYLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVKPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVS
IIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRSLNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELSMLDYDMVH
FPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLNVMQHLAKNIVMVNRGLTKHMTIKNKYAASKHAKISTLAQLNSALVQDLAKAVAKV*