SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau D    

ID / Description / Sequence
1 >lcl|NP_001035042.1|Plus1265460..265789 NW_001494610 prothymosin, alpha PTMA __SEG__ Chr2 {Bos taurus} MSDAAVDNSSEITTKDLKEKKEVVEEAENGREAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEGDGEEEDGDEDEEAEAATGKRAAEDDEDNDVDTKKQKTDKDD*
2 >lcl|NP_001070012.1|Plus12847020..2849365 NW_001493662 haspin GSG2 __SEG__ Chr19 {Bos taurus} MAASLPLPASGLFRTYGAAGGGRPRRRPGLAAVQWFPPQDRKRFFSSSSSDTSSGGPSQSVVSDDPDDPDFPGSPVGQRRRRAGARLAKGRPSQIATPRRLRLRSRCPQK
CSTPCGALEPPSFPNGNPGSLSPDLRVCGQPRDGGELGTSASLFSSLASPGPGFPAPEDSICTDPSTFLDAASEAPSNFHLPEASLDQAPLPCSQDAATGGGRFTRLAHQ
AQASLRSALFSFLDPGNPEDSELGTDGKNWQEFCHDRELVGRRLESPGLSGRGKKRTTDQDSCREIESQESVQIEYEEARGCKGGIASGKSNGPERTRLSRKRKHQGTAE
TSLLHHCQVTKGQKIEDGSCVTQDLTRLQNACSWTKTRASFSFHKKKIVTAVSEVCSCDTLAGSLSESLMSEYSHHPVQNRTSYALSPWHSSSMYLLTPLKTQQVTDKRT
SDAEKLYGECNQVGPIPFSDYLSEEKLECCEKIGEGVFGEVFQTVTNHTPVALKIIAIEGQDLVNGAHQKTFEEILPEIIISKELSLLSDEACNRTEGFIGLNSVHCVQG
SYPPLLLQAWDHYHSTKGSANDRPDFFGEDQLFIVLEFEFGGIDLEQMRKKLSSIATAKSILHQITASLAVAEASLHFEHRDLHWGNVLLKKTSLKELHYTLNGKTSSIP
TRGLQVNIIDYTLSRLERDGIVVFCDISRDEDLFMGQGDYQFEIYRLMRKENNNCWGEYHPYNNVLWLHYLTDKILNQMTFKSKHNTPALKRMKKQIQHFYQTMLNFSSA
TDLLCQHSLFK*
3 >lcl|NP_001071346.1|Plus1214977..215555 NW_001495157 nucleosome assembly protein 1-like 5 NAP1L5 __SEG__ Chr6 {Bos taurus} MADSQNQGSAEPSQAAAAAAAADAAAAAEEVMAEGGAQGGDSDSASSDSDGVVGQMAEEPQTPAENAPKPRNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQAL
EKKYNDIYKPLLAKIQELTGEMEGCAWTLEGDEEDDDDDEYEDEEEGEEEDEEEEEPAAEAAGTAAAKDEGPHSAVPDDAKK*
4 >lcl|NP_001072974.1|Plus122567..23085 NW_001494241 centrin-1 CETN1 __SEG__ Chr24 {Bos taurus} MASSYRKPTVASTSQKRKVGPKPELTEEQKQEVREAFDLFDADGSGTIDVKELKVAMRALGFEPRKEEMKRMIADVDKEGTGKISFNDFLAVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEDEFLRIMKKTNLY*
5 >lcl|NP_776937.2|Plus1complement(472781..473704) NW_001493658 cyclin-dependent kinase 5 activator 1 CDK5R1 __SEG__ Chr19 {Bos taurus} MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPP
ASQLSGSQTGVSSSVKKAPHPAVSSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDH
ELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR*
6 >lcl|XP_001249931.1|Plus1complement(139079..139960) NW_001494624 breast cancer metastasis-suppressor 1-like LOC781978 __SEG__ Chr2 {Bos taurus} MVRLLLIPSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKEQLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQ
ASRQHCESEKLLLYDTVQSKLEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAVATLGPHRVKTEPPVKLEKQ
LHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYLSQLQKGKYSIKHS*
7 >lcl|XP_001249945.1|Plus13995540..3996715 NW_001494883 nucleosome assembly protein 1-like 1 LOC782609 __SEG__ Chr4 {Bos taurus} MADIDNKEQSELDQDLDDAEEVEEEETGEETNIKARQLTVQMMQNPQILAALQERLDGLVETPTGYVESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
QPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKVEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEP
NEYFTNEVLTKTYRMRSEPDDSDPFSFEGPEFMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDCFCNFFAPPEVPESGDLDDDSEAILAADFEIGHFL
HEHIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ*
8 >lcl|XP_001250487.1|Plus11107322..1107687 NW_001493845 hypothetical protein LOC782016 __SEG__ Chr1 {Bos taurus} MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDEDDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDME
GNEQDQDQWMI*
9 >lcl|XP_001250807.1|Plus1complement(2040430..2041413) NW_001495544 FtsJ homolog 1 LOC783071 __SEG__ Chr9 {Bos taurus} MGWSSKDKRDVYYRLAKEKGWRARSAFKLLQLDEEFQLFQGVTRAIDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVLQIQGDITQLSTAKEIIQHFEDCPT
DLVVCDGAPDVTGLHVEYMQAQLLLAALNLAMHVLKPGGCFVGKIFRGRDVTLIYSQLRVFFSRVLCAKPRSSRNSSIEAFAVCKGYNPPEGFLPDLTKPLLDHSYDFNQ
LDGLSRIIVPFVTSGDLSAYDSDCSYPLDLEDGSEYKCTPPRQPPISPPYQEASTLKEKGQLAKDKEIRPQDCPTSTVDRMPQSLTVPQRHTLQPSEVEDSGVNYSS*
10 >lcl|XP_001254327.1|Plus1complement(1073664..1074182) NW_001493559 tumor protein, translationally-controlled 1 TPT1 __SEG__ Chr18 {Bos taurus} MIIYRDLISHDKMFSDIYKIREVADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPDGEGTESTVITGVDIVMNHRLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPER
VKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMETC*
11 >lcl|XP_001255560.1|Plus1585434..585946 NW_001494732 cytokine induced protein 29 kDa-like LOC788523 __SEG__ Chr3 {Bos taurus} MATETVELHKLKLAELKQECLARGLETKGIKQDLINRLQAYLEEHAEEEANEEDVLGDETEEEEPKPLELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERF
NVPVSLESKKAARAARFGISPVPSKGLSSDTKPMVNLDKLKERAQRFGLNVSSISRKSTS*
12 >lcl|XP_002700735.1|Plus1690572..690946 NW_001492885 doublecortin-like kinase 1 LOC100336133 __SEG__ Chr10 {Bos taurus} MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYT
IDGLKKISSLDQLLE
13 >lcl|XP_002703037.1|Plus1129082..129255 NW_001494222 anaphase promoting complex subunit 11-like LOC100336142 __SEG__ Chr24 {Bos taurus} MAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFKE*
14 >lcl|XP_002705238.1|Plus1complement(459383..459628) NW_001495583 neural precursor cell expressed, developmentally down-regulated 8 LOC100296298 __SEG__ Chr9 {Bos taurus} MLIKVKTLTRKEIEIDTEPTDKVEQIKERVKEKEGIPPEQQRLTYSGRQINVKKTSTDYRLLSGSVLHLVLALRGGGGLRQ*
15 >lcl|XP_582665.3|Plus12710200..2711738 NW_001493469 tigger transposable element derived 6-like LOC538784 __SEG__ Chr17 {Bos taurus} MAEAPVDASTLPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPML
RLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGVSADPSAVWHQNILPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFKGETCSIGKLCKDRITLVVGT
NMDGSEKLPLLLIGKNRNPRCFKGIQSLPVCYEANKMAWMTAEVFEQWMQKLDERFQAQQRRVVIFVESSPAHPEVKNLKSIELAFFPSCLSSKFIAMKQGVIRSLKIKY
RHCLIKKFLSSVEGSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEAGFKSQRGESEEASAETDTGLDLVADAQAAGVEFPEGLSVEEYAALDDDLETCEAAPSGDAVC
PKESESDETGFYTSDEEEDGGSLESELPLPSKNEAITALDTLKTFLRSQDINDELHNALADLEIFINSLSSK*
16 >lcl|XP_586437.2|Plus1complement(88567..89628) NW_001492858 transmembrane protein 30B TMEM30B __SEG__ Chr10 {Bos taurus} MTWSATARGAHQPDNTAFTQQRLPAWHPLLSASITLPLFFCAGLAFIGLGLGLYYSSNGIKELAYDYTGDSGTGNCSVCAMAGQGRAPPPPCSCAWYFSLPELFQGPVYL
YYELTNFYQNNRRYGVSRDDSQLSGLPSSLRHPVNECAPYQYSAAGLPIAPCGAIANSLFNDSFSLWHQRQPNGPYVEVPLDRTGIAWWTDYHVKFRNPPLVNGSLALAF
QGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFNGHKSLIFSSISWMGGKNPFLGIAYLLVGSLCIL
VGFVMLVVYIRYQDQNDDEEDDE*
17 >lcl|XP_589056.1|Plus1complement(2856784..2858358) NW_001493278 tigger transposable element derived 6-like JRKL __SEG__ Chr15 {Bos taurus} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPVSGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLSGDETAVEDFCSNFRDYIERENLQPEQIYNADETGLFWKCLPSRTSVIKGKCTVPGHKSMEERVTIMCCANATGL
HKLKLCVVGKAKKPRSFKSTDTSNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREHLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLNQGV
IATMKRNYRARLLQNNLEEGNDLRSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPTIEEKEGLDFDEEDISVAAIATILQHTKGLENVPTENIEKWLEVDSTEPG
YEVLTDSEIIKRAQGHTDESSENEEEEIELIPEKHINHAAALQWTENLLDYLEQQGDMILPDRLVIRKLRATIRNKQKMANSSQ*
18 >lcl|XP_589507.1|Plus15721240..5723543 NW_001494883 cullin 1-like isoform 1 CUL1 __SEG__ Chr4 {Bos taurus} MSSDWSQNPSELNHLGIDELWDNIRAGIQQVYARQSMVKSRYIELYTLLYNHCLYVSPQAQTQSKKGQKLREDKTVGFELYKRIKEFLKNHLTNLPKDGEDLMDIGILKF
YTQQWEDYQFSSKVLNGICARLNKHLLNSTNNEGHNVCEIYSLAMVTWRDCLFRPLNKQVTNAVLKLIEKERNGESINTRLISGAIQSYLELGVNEDNQFEESPMLTVYK
EAFESQFLADTERYYTRKSTELLQQNPVTEYMKKVEALLLEERRRARVYLHQSSKGKLARKCRQVLVEKHLEIFLTEFQNLLNANKSEDLGRMYRLIYRIKNGLGEFKKI
LETHIHNQGLSAIEECGEAALNDPRMYVETVLNIHKKYNALVISAFRNHADFVAALDKACSGFINNNAVTKMAQSSSKSPELLAQYCDSLLKKSSKNPEEAELEDTLNHV
MTVFKYMDDKDVVQKFYTKMLAKRLVHQNSASDDAEASMVSKLKQACGFEYTSKLQRMFQDIGVSKALNAQFKKHLMDSEPLDLDFSIHVLSYGWWPFEESCTVLLPSEL
EPCYRRFTAFYASCYSDRKLSWAYQLSEGELVTNYFKNNYTLRVSTFQMAILLQYNTEDAYTIQQLMDSTQIKMDIVAQVLQILLKFKLLVLEDKSANVDEVELKPDTLI
KLHFGYKSKKLRVNISLPMKIEQKREQETMYKNIEEDRKLLIQAAIVRIMKMRKVVKHQQLLGEVATQLSSVFKPQISVIKKCIDILIEKEYLERVGDEKDTYSYLA*
19 >lcl|XP_590891.3|Plus1451633..453048 NW_001494538 tigger transposable element derived 3 LOC513236 __SEG__ Chr29 {Bos taurus} MELCGKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELA
DILGQDFVPSIGWLVRWKRRNNVGFGARHILAPPFPPEPPPPAPTPQAQLPLSLKDFSPEDIFGCVEVPLLYRAVPGRAGTCDRVQVLLCANSRGTEKRRLLVCGPQAAP
RCFFGVSSEALPASYHPDLAIPWSEWLSQFDRDMGRQGRQVALLMAAQVVEEVAGLPGLCHVRLLPLSAASPTQPLPSSVVRAFKAHYRRRLLSKLAAAQSERACTLLAE
IGAGITVLDALHMAAAAWAKVPLQLIVSSFIQEGLAPGKTPVAQDQASEVLQVPGGLSLEEFSRFVDLESEEPVSGACKEEVGPADEAGGGEDGFEPLPTKADALQALGT
LRRWLECSGTTPELFENFYACEEGVERLCCL*
20 >lcl|XP_593945.4|Plus1complement(923465..925396) NW_001493178 tigger transposable element derived 5-like LOC540422 __SEG__ Chr14 {Bos taurus} MYSAGPPAVPAPRRCRRPPPGRPMQPPRPPAPAPVPAARPPPPAPGPRPRVAVKMAFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQL
GGEVGTQRKKMRLANEEEIDRAVYSWFLALRQHGVPLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPVAAGPAPGPPVNQEPAQPTRAGP
LPDRAASTPAPAEGGYGDEQIYNANVTGLYWKLLPEQAAPVGAGGCGRRWRGDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRG
WFFEEFVPGVRRYLRRSCLQQKAVLLVAHPPCPSSEARMPALEESEETRRRCRPEPTGPPEELQTPDGAVRVLFLCRGSGRAHIPAPLEQGVVAAFKQLYKRELLRLAVS
CAGGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPVEERAGQPAGQAEEAAEHSRVLSDLTHLAALAYKRLAPEEVAEWLHLDDDGGLPDGGRED
WGPSRPPVLVPGGPLLPASLPSAVAGGAEEEEEEAIPTAGEAVRGLETALRWLETQDPREVGPLKLVQLRSLISTARRLGGIGPSPMVPDDGL*
21 >lcl|XP_595799.2|Plus1complement(7302..8888) NW_001493183 jerky homolog JRK __SEG__ Chr14 {Bos taurus} MASKPAAGRSPGEKRKRVVLTLKEKMDICRRLEKGESRRALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSDKALAQRRTLHTPKLEHLDRVLYEWFLVKRSEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADQQAAEQFCGFFRSLTAEHGLSPEQVYNADETGLFWRCSPSPSPEGGSAPGPTQSKDRLTVLM
CANATGSHRIKPLVVGKWGSPKAVQGLQHLPVVYKAQGSAWVDKEIFADWFHHIFVPAVKEHFRAMALPEDSKAILLLDGSRAHPREAELASENVFTIFLPASVTALLQP
MDQGIRRDFMRNFVTPRGRLQALAPRCSVQDAVLDVACAWDAVPGAVLSRAWRKLWPEAALTEGSSSEEEPERLRTKPPDQAFTHTPGLTAGAPAHLGSAALGSLEPAEA
GGVDRAAWEQAAVSFDALVRFAEAQPCFSVQELGQLRALRSVFSRRWQAQRGRAPAAAVKLEAPWERPGPCGTQPCSPLPGSSTAGEA*
22 >lcl|XP_606959.3|Plus11570751..1571872 NW_001494678 cyclin-dependent kinase 5, regulatory subunit 2 CDK5R2 __SEG__ Chr2 {Bos taurus} MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRD
PPDGGGAAKPLAVPVPTVPAAAATCEPPSGSSAGVPPPGSGGGKPPPPPPPAPQAAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSL
LLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGE
ASASAGGPPNGGAPAAPSTSSSSSAARDSCATGAKHWTMNLDR*
23 >lcl|XP_869379.2|Plus139776..40951 NW_001495210 nucleosome assembly protein 1-like 1 isoform 6 LOC613882 __SEG__ Chr6 {Bos taurus} MADIDNKEQSELDQDLDDVEEVEEEETGEETKIKARQLTVQVMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
QPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKVEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFALEFHFEP
NEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDSEAILAADFEIGHFL
RERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ*
24 >lcl|XP_870495.1|Plus11216310..1217494 NW_001493128 nucleosome assembly protein 1-like 1 isoform 1 LOC614124 __SEG__ Chr13 {Bos taurus} MADIDNKEQSELDQDLDDVEEVEEEETGEETKIKAHQLTVQMMQNPQILAALQERLDGLVETPTGYAESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYSVLY
QPLFDKRFEIINAIYEPTEEECEWKPGEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDTVQEHDEPILKYLKDIKVKFSDAGQPMSFVLEFHFEP
NEYFTNEVLTKTYRMRSEPQGSDDSDPFSFDGPEIMGCTGCQIDCKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPETGDLDDDSEAILAADFEIG
HFLREHIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDCDPKKDQNPAECKQQ*