SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr C    

ID / Description / Sequence
1 >lcl|NP_001106758.1|Plus1914742..915746 NW_003299464 L-lactate dehydrogenase B chain LDHB __SEG__ Chr2 {Sus scrofa} MATLKEKLIVPVAEEETTIPNNKITVVGVGQVGMACAISILGKSLTDELALVDVLEDKLKGEIMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNL
VQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGVHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMG
TDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVQGMYGIENEVFLSLPCVLNARGLTSVINQKLKDDEVAQLKNSADTLWGIQKD
LKDL*
2 >lcl|NP_001193306.1|Plus1complement(119475..120269) NW_003300013 SCO cytochrome oxidase deficient homolog 2 SCO2 __SEG__ Chr5 {Sus scrofa} MLARAPKAWHGLFLLRPLALPRIQGAEAGQVRYRLLARQGPAETGKPGQPRGPRLQTRLLITALIGAGLGGAWLALRAEKEQWRQQQRTEALRRAAVGQGDFSLLDHRGQ
VRCKADFRGQWVLIYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPLFITVDPERDDVAAMARYVQDFHPRLLGLTGSAEQIAQVSRSYRVYYSAGPKDEDQDYIV
DHSIAIYLLSPDGLFTDYYGRARSAQQITDSVRGHMAAFRSVLH*
3 >lcl|XP_001926443.2|Plus178510..79655 NW_003533898 l-lactate dehydrogenase A-like 6B-like LOC100153697 __SEG__ Chr1 {Sus scrofa} MSWAMVVLRTSQRVGAKRVNLPCPAVAPSARRPAGLPLGDAWPVAPASKMSTVRCELMKNFTSEEVVHSNKISIVGTGSVGMACAISILLKGLTDELALVDVDESRLKGE
TMDLQHGSPFVKMPNIVSSKDYLITANSNLVIITAGARQEKGETRLNLVQRNVTIFKLMISSIVQYSPRCKLIVVSNPVDILTYVAWKLSEFPQNRIIGSGCNLDTARFR
FLIGQRLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKNLNLDIGTDKDPEQWKNVHKDVVASAYEIIKMKGYTSWAIGLSVADLTESILKNLRRVHPVSTRIKGLY
GINEEVFLSVPCILGESGITDLIKVKLTPEEEAYLQKSAKTLWEIQKELKF*
4 >lcl|XP_001927317.1|Plus1complement(348884..349921) NW_003535236 olfactory receptor 11H7-like LOC100152678 __SEG__ Chr7 {Sus scrofa} MNKTPCPKKSFKCLSSKVTFHCLSSLHSLGTMNKSEISTVTQFVLLGFPGPWKMQITFFSMILLVYVLTLTGNMAIICAVKRDHRLHTPMYMFLANFSFLEIWYVTCTVP
NMLANFLSKTKTISFSSCFTQFYFFFSLGTTECFLLCVMAYDRYLAICRPLHYPSIMTGQLCAILVCLCWLTGFLGYSIPIFFIFQLPFCGPNIIDHFLCDVNPLMALSC
APSPIIKHVFYSLSSIIIILTILYILGSYTLVLRSVLQVPSSAGRQKAFSTCGSHLVVVSLFYGTIMVMYVTPASGNSVAMHKIITLIYSIVTPFLNPLIYSLRNRDMKS
ALHQVLCGMRIIQSS*
5 >lcl|XP_001927439.1|Plus1428350..428667 NW_001885303 cytochrome c-like LOC100158196 __SEG__ Chr13 {Sus scrofa} MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGWKTGQAPGFTYTDANKSKGVTWGEETLMEYLENPKKCIPGMKMIFAGIKKKGEREDLGAYLKKATNE*
6 >lcl|XP_001927684.1|Plus11797934..1798815 NW_003536501 UDP-glucuronosyltransferase 1-10-like LOC100157045 __SEG__ Chr15 {Sus scrofa} MAPVVLTRFLPLCVCLLLSPGFAEAGKLLVVPMDGSHWFTMRSVVEKLIHRGHEVVLVTPEVSWQLTNSFNMTVKTYSTTYTLEDLNREFQIFSDFQWKARQMSMFSMLM
SESTKFFDYFFSHCGSLFNDTKLVKYIEESSFDAVFLDPFDMCGLIVAKYFSLPAVVFTRGPFCHHLEESTQCPMPLSYVPRELSAFSDVMTFGERLRNHIWHLEERLFC
HYFVKRALEIASEIFQTKVTAYDLYSQASVWLLRTDFVLDYPKPVMPNMIFIGGINCHEGKPLPKVRYSPAAY*
7 >lcl|XP_003121676.1|Plus1157306..157599 NW_003534018 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-like LOC100156045 __SEG__ Chr1 {Sus scrofa} MAHGHGREHGQSKMGLPDYKQWKIEGTSLETAQERAARGLRNPWGHNKAWRYIGGFANNVSFVGALLKGFKWGFAAFMVAARAEYYLESWKIDKKHR*
8 >lcl|XP_003123169.1|Plus1complement(1146973..1147287) NW_003534269 cytochrome c-like LOC100519295 __SEG__ Chr2 {Sus scrofa} MGDVEKNKIFVQKCAQCHTVEKGGKQKTGPNLHGLFGWNTGQTVGFSSVDVNKNKGITWGEETLREYLEDRKKYIPGTKMIFVSIKKKGEKGDLIAYLKKAASE*
9 >lcl|XP_003124105.1|Plus1complement(144151..145053) NW_003534376 mitochondrial ornithine transporter 2-like LOC100523054 __SEG__ Chr2 {Sus scrofa} MNCSPALQAAIDLTAGALGGTACVLTGQPFDTMKVKMQTFPGLYKGLADCGLKTYAQVGLRGFYKGTGPALMACVAENSVLFMCYGFCQQFVRKVVGLDQQEKLRDLQTA
AAGSSASAFAALALCPTELVKCQLQTMLELEMSGRLAKSPKTVWGVVKSILRKDGPLGFSHGLWSTLLQEVPGYFFFFGGYELSRSFFASGGSKDELGPVPLMLSGGIAG
ICLWLVIYPVDCVKSRIQVLSMFGKQAGFMGTLLSVVKNEGIAALYSGMKATLIRAFPANGSLFLAYEYSRKLMMSQFEA*
10 >lcl|XP_003124773.1|Plus1543891..544187 NW_003534456 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2-like LOC100515604 __SEG__ Chr3 {Sus scrofa} MAAAAASRGIRAKLGLREICIHVCQHSPGSQGVRTSSRNTVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRTLENVLSGRA*
11 >lcl|XP_003127032.1|Plus1complement(101147..101395) NW_003534932 cytochrome c oxidase subunit 6B1-like LOC100519366 __SEG__ Chr6 {Sus scrofa} MAEDIQTKIKNYQTAPFESHFPSQNQTRNCWQNYLDFHCCEKAMTAKGGDTSVCEWYQRVYKSLWVSAWHVHRAEGTFPGKI*
12 >lcl|XP_003131860.1|Plus1111568..111885 NW_003300956 cytochrome c-like LOC100523020 __SEG__ Chr12 {Sus scrofa} MGDVEKGKKVFVQKGAQCHTVEKGGKHKTGPNLHGLFGQKTGQAPGFTYTDANKHKGIPWGEETLLEHLENPKKYIPGTKMVFAGIKTEGERDDLVACLKKATPE*
13 >lcl|XP_003131897.1|Plus1complement(403112..403429) NW_003535907 cytochrome c-like LOC100515795 __SEG__ Chr12 {Sus scrofa} MGDLEKGKKVFVQKGAQCHTVEKGGKHMTGPNLHGLFGQKTGQAPGFTYTDANKHKGIPWGEETLLEHLENPKKYISETKMVLAGIKTEGERDDLVACLKKATPE*
14 >lcl|XP_003132737.1|Plus1436212..436622 NW_001885244 ATP synthase lipid-binding protein, mitochondrial-like isoform 2 LOC100519871 __SEG__ Chr13 {Sus scrofa} MQTTGALLISPALLRSCTRGLIRPVSASFLSRPEIPSEQPPCSSVPLQVARREFQTSVVSQDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNLSLKQQLFSC
AILGFALSEAMELFCLMVAFLILLAM*
15 >lcl|XP_003133465.1|Plus1complement(430132..430425) NW_003536420 cytochrome c-like LOC100521823 __SEG__ Chr15 {Sus scrofa} MGDVEKGKNIFVQKCSQCHTVEKGGKHTSGPNLHGLFGWKTGHAPGFTYSDATKNKGNTRGEETLMEYLENPNKYILGAKRIFTGIKEKDLVAYLKK*
16 >lcl|XP_003133974.1|Plus1complement(721244..721726) NW_003536546 ATP synthase subunit d, mitochondrial-like LOC100525437 __SEG__ Chr16 {Sus scrofa} MAGQKLALKAIDWVALGEIIPQNQKAIANSLKSWNETLSTRLTALPEKPPAIDWPYYKATMAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKRCAEFLSLSNT
RTEAYEKELEKMNIIPFNQIIIEDLNEVFTETKLDKKTYPYWPHRPIESL*
17 >lcl|XP_003135254.1|Plus1complement(737806..738126) NW_003536802 cytochrome c-like LOC100517742 __SEG__ ChrX {Sus scrofa} MDDVEKGKKIFIQKCAQCHTVEKGGKHKTGPNLHGLFGQKTGQAPGFTYTDANKNKGITWGEKLMEYLEKHKKYIPGTKMIFAGIKKAGEREDLVAYLKNLLMSKS*
18 >lcl|XP_003353222.1|Plus1complement(230638..231783) NW_003533898 l-lactate dehydrogenase A-like 6B-like LOC100628210 __SEG__ Chr1 {Sus scrofa} MSWAMVILRTSQRVGAKRVNLPCPAVAPSARRPAGLPLGDAWPVAPASKMSTVRCELMKNFTSEEVVHSNKISIVGTGSVGMACAISILLKGLTDELALVDVDESRLKGE
TMDLQHGSPFVKMPNIVSSKDYLITANSNLVIITAGARQEKGETRLNLVQRNVTIFKLMISSIVQYSPRCKLIVVSNPVDILTYVAWKLSEFPQNRIIGSGCNLDTARFR
FLIGQRLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKNLNLDIGTDKDPEQWKNVHKDVVASAYEIIKMKGYTSWAIGLSVADLTESILKNLRRVHPVSTRIKGLY
GINEEVFLSVPCILGESGITDLIKVKLTPEEEAYLQKSAKTLWEIQKELKF*
19 >lcl|XP_003353633.1|Plus1254934..256487 NW_003534140 aldehyde dehydrogenase X, mitochondrial-like LOC100524065 __SEG__ Chr1 {Sus scrofa} MLHFLVPRLFGLCRPVAPYSSAAALPSPILNPDIRYNQLFINNEWQDAVSKKTFQTVNPTTGEVIGHVAEGDQADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLAD
LVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQAWKLAPALATGNTVVMKVAEQTPLSALY
LASLIKEVGFPPGVVNILTGYGPTAGTAIAHHMDVNKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMDHAVEQCHEALFFNMGQCCCAGSRTFVEES
IYDEFLERTVEKAKRRKVGNPFELDTQQGPQVNKEQFERILGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKRIEEVIERANNT
RYGLAAAVFTQDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKDS*
20 >lcl|XP_003353634.1|Plus1355418..356971 NW_003534140 aldehyde dehydrogenase X, mitochondrial ALDH1B1 __SEG__ Chr1 {Sus scrofa} MLHFLVPRLFGLCRPVAPYSSAAALPSPILNPDIRYNQLFINNEWQDAVSKKTFQTVNPTTGEVIGHVAEGDQADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLAD
LVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQAWKLAPALATGNTVVMKVAEQTPLSALY
LASLIKEVGFPPGVVNILTGYGPTAGTAIAHHMDVNKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMDHAVEQCHEALFFNMGQCCCAGSRTFVEES
IYDEFLERTVEKAKRRKVGNPFELDTQQGPQVNKEQFERILGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKRIEEVIERANNT
RYGLAAAVFTQDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKDS*
21 >lcl|XP_003355048.1|Plus11137089..1137265 NW_003534609 mitochondrial folate transporter/carrier-like LOC100624848 __SEG__ Chr4 {Sus scrofa} MSGQGQTASASSAWSSIFRHVRYENLVAGVSGGVLSNLALHPLDLVKIRFAGKRQLRL*
22 >lcl|XP_003357094.1|Plus1complement(<34858..35118) NW_003535438 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like LOC100628237 __SEG__ Chr8 {Sus scrofa} MNLLQRMKNTGVYLISRLAVSFLVLPRYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPE
23 >lcl|XP_003357262.1|Plus1complement(<3367..3774) NW_003535505 hypothetical protein LOC100624922 LOC100624922 __SEG__ Chr9 {Sus scrofa} MTMMSGRPGRVPLQFLPNEARSLPPPKLTDPRLVYMGFLGYCSGLIDNAIRRRPVVSAGEGCAGWIGWEEWGSRGSGPAPPQAARGAFAFQGLSPKRPRLAFLRFACPLS
SSASGPTRASLHFRSNRGCNANHDLT
24 >lcl|XP_003357320.1|Plus1819249..819566 NW_003535536 cytochrome c-like LOC100626234 __SEG__ Chr9 {Sus scrofa} MGDVKKGKKIFVQKCAQCHTVEKGGKHKTGPNLQGLFGWKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYVPGTKMIFAGIKKKGDREDLIAYLKKATNE*
25 >lcl|XP_003359371.1|Plus1complement(519079..519609) NW_003536292 mitoferrin-2-like LOC100622979 __SEG__ Chr14 {Sus scrofa} MVLPVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALN
SNITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEWRAGK*
26 >lcl|XP_003359727.1|Plus1complement(1615318..1616076) NW_003536501 UDP-glucuronosyltransferase 1-3-like LOC100626734 __SEG__ Chr15 {Sus scrofa} MAMGFQAPLPMLAGLLLCLCVVVPWAEGGKVLVVPMEGSHWLSMRKAVQELHARGHQAVVLSPEVNMHIKAEDFFTVKSYATPYTQDEFDDLMVGHFHLLFEKVNFLTMF
WTTMVSLKKVFLMFERSCEELLNNKDLIRDLNASSFDVVLTDPVYPCGAVLAKYLSIPAVFFLRSLPCDLDFEGTACPNPFSYVPKLLTMNSDHMTFFQRVKNMLYPLAL
KYICHVFVTPYAQMASKLRNQNRHHADGPRAA*
27 >lcl|XP_003359818.1|Plus1complement(836136..836618) NW_003536546 ATP synthase subunit d, mitochondrial-like LOC100621795 __SEG__ Chr16 {Sus scrofa} MAGQKLALKAIDWVALGEIIPQNQKAIANSLKSWNETLSTRLTALPEKPPAIDWPYYKATMAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKRCAEFLSLSNT
RTEAYEKELEKMNIIPFNQIIIEDLNEVFTETKLDKKTYPYWPHRPIESL*