SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor C    

ID / Description / Sequence
1 >lcl|NP_001011975.1|Plus12403384..2404943 NW_047712 aldehyde dehydrogenase 1B1 precursor Aldh1b1 __SEG__ Chr5 {Rattus norvegicus} MLNARFLVPRLLCLQGRTTSYSTAAALPNPIPNPEIRYNQLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVRAAREAFRLGSPWRRMDASERGRLLNRL
ADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSA
LYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMDHAVDQCHEALFFNMGQCCCAGSRTFVE
ESIYHEFLERTVEKAKKRKVGNPFELDTQQGPQVDKEQFEKILGYIRLGQKEGAKLLCGGERFGERGFFIKPTVFGNVQDDMRIAREEIFGPVQPLFKFKKIEEVIQRAN
NTRYGLAAAVFTRDLDKALYFSQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVSEKNS*
2 >lcl|NP_001012221.1|Plus13589994..3591556 NW_047719 3-oxoacid CoA transferase 2A precursor Oxct2a __SEG__ Chr5 {Rattus norvegicus} MAALRLLAWAFSRRVSAHRPQPTLPHHLIRHYPTTRCGKVKFYTDPVKAVEGIKDGASVMLGGFGLCGIPENLIGALKTKGVKDLKIISSNVGVDDFGLGILLASKQVRR
VVCSYLGENKLCEQLYLAGKLELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTQVQEGGVPIRYSPEGHLITLSQPREVREFEGQHHLLERAIRADFALIKGWKADRSGN
VIFRGSARNFNVPMCKAADISVVEVEEIVDVGTFAPEDIHIPNIYVKRVIKGPRFEKRIERLTTRDSPPAPGSKDQDPKRTRIIKRAALEFKDGMYANLGIGIPVLASNY
ISPKMTVYLHSENGILGLGPFPLKKEVDPDIINAGKQTVTVIPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMVPGKKVKGMGGAMDLVSSKKTKVVVTME
HCTKTKQPKILEKCTMPLTGKSCVDLIITEKAVFEVDRSKGLKLVELWEGSSLDEVKATTGCSFKVCPNLKPMQQIKSDA*
3 >lcl|NP_001099622.1|Plus1complement(2120289..2121086) NW_047511 solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2 Slc25a2 __SEG__ Chr18 {Rattus norvegicus} MQTFPYMYKGLADCFLKTYNQVGVHGLYRGTSPALLAYVAQGSVLFLCYGFCQQFVRKVARVEQSAELNDFETATAGSLASAFAALVLCPTELVKCRLQTMHEMRVAGKT
KHSHNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFASGGSKDELGPVPLMLSGSFAGVCLWLIIFPVDCIKSRIQVLSMFGKPAGLIKTFINV
VRNEGILALYSGLKATLIRAIPSNAALFVVYEYSRKMMMNVVEEY*
4 >lcl|NP_001102449.1|Plus1complement(8707594..8708274) NW_047754 ATPase, H transporting, lysosomal V1 subunit E2 Atp6v1e2 __SEG__ Chr6 {Rattus norvegicus} MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKEAKMRLSRIVSDEE
FYQDLLDKLVLQALLRLLEPVMIVRCREQDFYLVQSALLRAIPQYMMLCQKHLEVQIDQTEYLSSNAAGGVEVYSSDRKIKVSNTLESRLNLAALQNMPEIRRTLFGDNS
NRKFFT*
5 >lcl|NP_001163936.1|Plus1complement(<2383009..2383158) NW_047430 ubiquinol-cytochrome c reductase complex 7.2kDa protein LOC685322 __SEG__ Chr14 {Rattus norvegicus} MASPTVTSRLYSLLFRRTSTFALTIAVSALFFERAFDQGADAVYDYINEG
6 >lcl|NP_036710.1|Plus111603950..11604534 NW_047780 histone H1.0 H1f0 __SEG__ Chr7 {Rattus norvegicus} MTENSTSTPAAKPKRAKAAKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKGDEPKRSVAFKKT
KKEVKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKAKKPKIVKVKPVKASKPKKAKPVKPKAKSSAKRASKKK*
7 >lcl|NP_872612.1|Plus1complement(9222552..9223619) NW_047760 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 10-like Ndufa10l1 __SEG__ Chr6 {Rattus norvegicus} MALRLLRLVPASASARGLAAGAQRVGRIHTSVHCKLRYGLLASILGDKTTKKLHEYSRVITVDGNICSGKNKLARDIAEQLGMKHYPEAGIQYSSSTTGDGRPLDIEFSG
SCSLEKFYDDPKSNDGNSYRLQSWLYASRLLQYSDALEHLLSTGQGVVLERSIYSDFVFLEAMYNRGFIRKQCVDHYNEIKRLTLPEYLPSHAVIYIDVPVSEIQSRIQK
KGDPHEMKVTSAYLQDIEDAYKKTFLPQMSEICEVLMYSSWEAEDSTKVVEDIEYLNYNKGPWLKQDDRTFHNLRMLVQDKREVLNYTTVPVYLPEITIGAHQGSRIYDS
FRELPGRKYAPGYNADVGDKWIWLK*
8 >lcl|XP_001053320.1|Plus13937750..3938067 NW_047550 cytochrome c, somatic-like LOC679794 __SEG__ Chr1 {Rattus norvegicus} MCDVEKGKKIFVQECAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKSKGIAWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATDE*
9 >lcl|XP_001053597.1|Plus1complement(182572..182940) NW_047802 lethal (2) 06225-like LOC679586 __SEG__ Chr8 {Rattus norvegicus} MKILISAGGSGRRTFHLRPWPKFICNFTEKASLMVAAAVTYSEPRLATFWHYAKVELVPPTPGEIPTAIQNMKKIIHSAKAGGFKHLTVKEAVLNGLVATEVWMWFYIGE
ILGKRGVVGYDV*
10 >lcl|XP_001054040.1|Plus1213181..213492 NW_047754 lethal (2) 06225-like LOC679690 __SEG__ Chr6 {Rattus norvegicus} MAKFICNFVEKAPSVMAAAVTYLKPRLATFLHYAKVELVPPTPGEIPTAIQSMKKIIQSAKTCGFQHLTVKEAVLNGSVATEVWMWFYIREIIGKRGIVGYDV*
11 >lcl|XP_001055503.1|Plus1complement(1971174..1971476) NW_047506 lethal (2) 06225-like LOC680026 __SEG__ Chr18 {Rattus norvegicus} MAKYIHNFSEKAPSMVATAMTYSKPLLATFWHYVKVELVPPTPGEIPTAIQSVKNIIHSAKAGGFKHLTVKEAMLNGLVATEVWMWLYIIGKRGIVGYDI*
12 >lcl|XP_001064469.1|Plus115588695..15589030 NW_047560 ubiquinol-cytochrome c reductase binding protein LOC685596 __SEG__ Chr1 {Rattus norvegicus} MAGQPAVAASSKWLDGFRKWYYNAAGFNKLGLMRDDTMHETEDVKEAIRRLPENLYNDRMFRIKRALDLSMRHQILPKDQWTKYEEDKFYLELYLKEVIRERKEREEWAK
K*
13 >lcl|XP_001069534.1|Plus1complement(13189575..13189874) NW_047562 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2-like LOC691015 __SEG__ Chr1 {Rattus norvegicus} MAAAAASPVVGAKPALHEIHIHLCQRSPGSQGGRDFIQQWYVELKKVHPDLPILIRECSEVQSKLWAHYAFGQEKNVSLNNLSAAEVTRAMENVLSSKA*
14 >lcl|XP_001070212.1|Plus1101086..101352 NW_047375 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 LOC689271 __SEG__ Chr12 {Rattus norvegicus} MAFIVPLKEKTLMEVKLGELPSWILMRDFTPNGIAGAFQRGYDRYYNKYINVRKGSISGINMVLAAYVVFSYGISYKELKHERRRKYH*
15 >lcl|XP_001070892.1|Plus18635117..8635476 NW_047605 cytochrome c, somatic-like LOC689459 __SEG__ Chr20 {Rattus norvegicus} MGDVEKDKKTFVQKCAQCHTVERGGKHEIGPKLHGLFMWKTGQAAGLSYTVANKNKGITLREDTMMEYLENPRKYIPATKMIFTGIKKGERANLIAYLKRLLISNSTAVF
ITKQMSHGF*
16 >lcl|XP_001072698.1|Plus118087352..18087762 NW_047563 ATP synthase lipid-binding protein, mitochondrial-like LOC689961 __SEG__ Chr1 {Rattus norvegicus} MQTTKELLISPVLILSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISRDIDTAAKFIGAGTATVGVAGSGAGVGTVFGSLIIGDARNPSLKQQLFAY
AIPGFALSEAMGLFCLMVAFLILFAM*
17 >lcl|XP_001075173.1|Plus1complement(23403759..23404076) NW_047334 cytochrome c, somatic-like LOC690675 __SEG__ Chr10 {Rattus norvegicus} MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKTTNE*
18 >lcl|XP_001076026.1|Plus132050710..32050973 NW_047711 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6-like LOC690885 __SEG__ Chr5 {Rattus norvegicus} MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWNNFLRDRALWKYMVSDVPHRSGFPLRVATRPTPSHSSQFH*
19 >lcl|XP_001081133.1|Plus136716105..36716428 NW_047454 ubiquinol-cytochrome c reductase binding protein LOC692017 __SEG__ Chr15 {Rattus norvegicus} MAGRPAVVALSKWLDGFPKWYYDTTIFNNLGLMRDDTIPETEDIRESIRRLPEDLSSDSMFQIKRAPDLSMKHQILPKDQWIKYEEDKFYLEPYLKEVIWERKEREE*
20 >lcl|XP_002728177.1|Plus1644865..645023 NW_047430 ATP synthase subunit epsilon, mitochondrial-like LOC100361879 __SEG__ Chr14 {Rattus norvegicus} MVAYWQQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIKTVKVKKPD*
21 >lcl|XP_002728188.1|Plus1complement(3619706..3620026) NW_047431 rCG31129-like LOC100361505 __SEG__ Chr14 {Rattus norvegicus} MPFLDVQKRLGISLDRHFIFLSAEQPYKNAARCHAFEKEWIECAHGIGATRAKKECKIEYEDFEECFLRFKTIRRMHEIKKQREKLMKEGKYTPPPHHLGKEEPRP*
22 >lcl|XP_002728351.1|Plus1complement(57454117..57454311) NW_047454 ubiquinol-cytochrome c reductase complex 7.2kDa protein LOC100361126 __SEG__ Chr15 {Rattus norvegicus} MASPTVASRLYSLLFHRTSTFALTIAVSSLFFERAFDQGADAIYDHSKEGKLWKHIKHKYENQE*
23 >lcl|XP_002728535.1|Plus1complement(14085103..14085405) NW_047492 NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3-like LOC100362391 __SEG__ Chr17 {Rattus norvegicus} MAAGHGHEHGHGHGKMELPDYRQWKIEGTPLEAMQKKFAAQGLRDPWAHNEAWRYMGGFASNVIFTSVIVKGLKWGFAVFVVALGAEYFLTSQNECKKHH*
24 >lcl|XP_002728600.1|Plus1complement(9250439..9250756) NW_047514 cytochrome c, somatic-like LOC100363502 __SEG__ Chr18 {Rattus norvegicus} MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE*
25 >lcl|XP_002729126.1|Plus116095890..16096210 NW_047626 rCG31129-like LOC100363268 __SEG__ Chr2 {Rattus norvegicus} MPFLDVQKRLGISLDRHFIFLSAEQPYKNAARCHAFEKEWIECAHGIGATRAKKECKIEYEDFEECFLRFKTIRRMHEIKKQREKLMKEGKYTPPPHHLGKEEPRP*
26 >lcl|XP_002729154.1|Plus1complement(33212954..33213253) NW_047627 NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3-like LOC100361144 __SEG__ Chr2 {Rattus norvegicus} MAAGHGHEHGHGHGKMELPDYRQWRIEGTPLEAMQKKLAARGLRDPWARNEAWRYMGGFADNITFTSVMLKGFKWGFAAFVVALGAEYFLTSHEVKKHH*
27 >lcl|XP_002729194.1|Plus1complement(9575637..9576077) NW_047651 Cytochrome c oxidase subunit 5A, mitochondrial-like LOC100361427 __SEG__ Chr3 {Rattus norvegicus} MLATALRRCTAAAAARGLLHPVSAPSPAAAVCSVRCYSHESHETDEEFDARWVTYSNKPDIDAWELRKGMDTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKD
KAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV*
28 >lcl|XP_002729307.1|Plus1193989..194429 NW_047668 Cytochrome c oxidase subunit 5A, mitochondrial-like LOC100361008 __SEG__ Chr3 {Rattus norvegicus} MLATALRRCTAAAAARGLLHPVSAPSPAAAVCSVRCYSHESHETDEEFDARWVTYSNKPDIDAWELRKGMDTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKD
KAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV*
29 >lcl|XP_002729362.1|Plus1complement(17345473..17345775) NW_047693 NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3-like LOC100363231 __SEG__ Chr4 {Rattus norvegicus} MAAGHGHEHGHGHGKMELPDYRQWKIEGTPLEAMQKKFAAQGLRDPWAHNEAWRYMGGFASNVIFTSVIVKGFKWGFAVFVVALGAEYFLTSQNECKKHH*
30 >lcl|XP_002729527.1|Plus19043654..9043947 NW_047713 cytochrome c oxidase subunit VIb polypeptide 1-like LOC681754 __SEG__ Chr5 {Rattus norvegicus} MAEEIKIKIXXXKTAPFDXXFPXQNQTKNCWQNYLDFRHCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWDDRIAEGTFPGKIRPGSAHLSYAL*
31 >lcl|XP_002729573.1|Plus1complement(3794666..3796228) NW_047719 rCG31267-like LOC100361036 __SEG__ Chr5 {Rattus norvegicus} MAALRLLAWAFSRRVSAHRPRPTLPHHLIRHYPTTRCGKVKFYTDPVKAVEGIKDGASVMLGGFGLCGIPENLIGALKTKGVKDLKIISSNVGVDDFGLGILLASKQVRR
VVCSYLGENKLCEQLYLAGKLELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTQVQEGGVPIRYSPEGHLITLSQPREVREFEGQHHLLERAIRADFALIKGWKADRSGN
VIFRGSARNFNVPMCKAADISVVEVEEIVDVGTFAPEDIHIPNIYVKRVIKGPRFEKRIERLTTRDSPPAPGSKDQDPKRTRIIKRAALEFKDGMYANLGIGIPVLASNY
ISPKMTVYLHSENGILGLGPFPLKKEVDPDIINAGKQTVTVIPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMVPGKKVKGMGGAMDLVSSKKTKVVVTME
HCTKTKQPKILEKCTMPLTGKSCVDLIITEKAVFEVDRSKGLKLVELWEGSSLDEVKATTGCSFKVCPNLKPMQQIKSDA*
32 >lcl|XP_002730087.1|Plus117761466..17761885 NW_047816 ATP synthase lipid-binding protein, mitochondrial-like LOC100361833 __SEG__ Chr9 {Rattus norvegicus} MYACSKFVSTLIRSASQLPSRLLSAVELKRPQMPTHKGLSCLAVRRPLTSLIPSRTFQTRAISRDIDTAAKFTGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQL
FSYSILGFTLSEAMGPFCLMVAFLILFAI*
33 >lcl|XP_218743.3|Plus1complement(455812..456753) NW_047559 solute carrier family 25, member 19-like RGD1561206 __SEG__ Chr1 {Rattus norvegicus} MVGYDSKADARSNSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQLERVCPSDPDAKYHGIFQAAKQIIQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTVLLYQA
NLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPNLREAIITMYRTEGPFVFYKGLTPTVIAIFPYAGLQFCYRSLKRTYDWVMPPDRKQTGNLKNLLCGCG
SGVISKTLTYPLDLFKNHLQVRGFEYARSAFGQVRSYRGLLDLARQVLQHEDTRGFFKGLSPSLMKAALSTGFMFFWYELFCNLFHCIRREDR*
34 >lcl|XP_235062.1|Plus19388993..9389427 NW_047774 rCG38845-like Ndufa13 __SEG__ Chr7 {Rattus norvegicus} MASKVKQDMPPPRGYGPIDYKRNLPRRRGLSGYSMFALGIGALIFGYWRIMRWNRERRRLLIEDLEARIALMPLLQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESM
FHTTRWVPPLIGELYGLRTKEEMENANFGFTGYT*
35 >lcl|XP_235352.4|Plus114301249..14302304 NW_047779 KIAA0089-like isoform 2 RGD1563100 __SEG__ Chr7 {Rattus norvegicus} MGATTLRVCIVGFWSWGSAIAKIIGTNVKNQQKFASTVKMWVSEEAVNGRKLTDIINHYHENVKYLPGHKLPENVVAVANLSEAVQDADLLVFTTPHQFIHKICNEITGR
VPKKALGIIHMESIDEGPRGLMLISDIIREKIGMDVSVLMGANTAREVAAGEFCETTIGSKVIQNGILFKELLQTSNFCITVVDDADAVELCGALKHIVAMGTNFCNGLH
CGNNSKAAVLRLGLVEMITFTRIFCKSQVSTTTFLESCGFANPITICYRGSDCKEAKTFPRIGKTMGNLQKEVLNGQTLQGLKTSALVYQFLKQKGLLAKFPLFVTVYRI
CYEGRPSTEILTCLQNHPAHM*
36 >lcl|XP_344253.3|Plus1421099..421563 NW_047428 hypothetical protein Hbld1 __SEG__ Chr14 {Rattus norvegicus} MAAARALSLTVEAFGAPIPRRQGRLLAAFPRLLTRWETTSSIPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDS
DNLAYVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKI*
37 >lcl|XP_344453.1|Plus1complement(61115530..61115841) NW_047454 lethal (2) 06225-like RGD1565438 __SEG__ Chr15 {Rattus norvegicus} MAKFIRNFVEKALSMVAAAVTYSKPRLATIWHYAKVELVPPTAGEIPTATQSVKKIIQSAEAGGFKHLTVKEAVLHGLVATEVWMWFYMGEIIGKRGIVGYDV*
38 >lcl|XP_345370.3|Plus11697292..1697633 NW_047656 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 RGD1560451 __SEG__ Chr3 {Rattus norvegicus} MASTTRTIQKLLNWASGQDRQAKLQLRYLEITKWTQPPPKLPVGPSHKLPNNYYCTHDGRREVVPPSIIMSSQNALVLGKTAESSAVAAIEKRAMTPAPPMERWELSRDQ
PYL*
39 >lcl|XP_576027.1|Plus116138546..16138944 NW_047760 ATP synthase lipid-binding protein, mitochondrial-like RGD1559629 __SEG__ Chr6 {Rattus norvegicus} MQTKALLISPVTIRSCTRGLIRPVSASLLSRPEAPSKTSFCSSLHLQVARQEFQTSFISDTAAKFIDAGAATVGVAGSGAAIGTVFGNLIIGYARNLSLKQQLSSYPILG
FALSEVMRLFCLMVTFLILFTM*
40 >lcl|XP_577408.1|Plus12658642..2658986 NW_047453 ATPase, H+ transporting, lysosomal V1 subunit F LOC501979 __SEG__ Chr15 {Rattus norvegicus} MAGRGKPVTDEDTLTGFLLGSIGELNKNRHPNFLVVEKDTTINEIEDTFRMFLNRDDIGIILIYIAETVRLALDAHGRSIPAVLEIPSNKHPHDAAKDSILRRAKGQFAA
EDLR*