SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus C    

ID / Description / Sequence
1 >lcl|NP_001104758.1|Plus1complement(50488117..50488884) NT_039621 protein SCO2 homolog, mitochondrial precursor Sco2 __SEG__ Chr15 {Mus musculus} MLLALGPKAWPKLSQFKPLLRISGGETLHRNSRHWAGQGQRQGPGLRTRLLITALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQGDFSLLDHKGQPRCKADFRG
QWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLL
NPDGLFTDYYGRSRSAEQIVESIRRHIAAFHSVLP*
2 >lcl|NP_001152747.1|Plus1complement(34797331..34798128) NT_039674 mutant ornithine transporter 2 Slc25a2 __SEG__ Chr18 {Mus musculus} MQTFPQLYKGLADCFLKTYNQVGIRGLYRGTSPALLAYVTQGSVLFMCFGFCQQFVRKVARVEQNAELNDLETATAGSLASAFAALALCPTELVKCRLQTMYEMKMSGKI
AQSYNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFASGGSKDELGPVPLMLSGGFAGICLWLIIFPVDCIKSRIQVLSMFGKPAGLIETFISV
VRNEGISALYSGLKATLIRAIPSNAALFLVYEYSRKMMMNMVEEY*
3 >lcl|NP_001161390.1|Plus1complement(999698..1003045) NT_109317 hypothetical protein LOC442834 D830031N03Rik __SEG__ Chr4 {Mus musculus} MGKPLSRPDCLRRNPTCLGKGEDEDGYIEDCYVPQRSIYDTMRINEQIDQGSKLNQTSKSTMEKMEGSTISSNGTLGASSNVFEARGPEGKKLDERIIFDALKLSSDVQK
SAPVPPRRRPNAERKDNVNRRSWKSFMPPNFPEFAERMEASLSEVSEAGASNPSLQEKKESSSALTESSGHFDHREPQSESVTLEHMSKSVDIPEVQNVKNLRDCQDFKF
QQHSESSPHEFQPLGSEAAAASGNTDEMQEHRFSSATWPRAMKSSSKGGFSEKQYPLGDTACAVELPPLSPCLSEELLDPELHMLITPSLREKTESELKFEEDERWIMME
AEEEWEEEKLSEERKSLVTNEETSLADPLEESDQANSVPAVEDGSDRVAVSGTSDHLALHQMCCSVDLQPTRDQLASVPRGSPPDCTCVPAGDTVISEVKNRPDQGLEGL
TSGLQCPVEAEQLSDTDSVQMFLELEKECLCEEGVTSSAELLSQASSEGLAPTQDAEDSLLISHFPGAALEQEQHVGFLSVRIKDPDTGLDGEYCNALDSSQVPKAVELC
AQPDSGRDASTISKECEKVPFSPKIGGEFKLLADLEPHSELDTGGLLNSNLRASCEENLPVFIASELAKENGNLSQVDCSQTEGNVEEYMERIPLSFAFNYEQDVTSGPE
VEVFSSDSNLLTDEIHLESGKGALISQEDSNLASLGNVDLCELSMEKVCDKDGETKEPGCQGKLLGNGAPAQFPTDFQRRSSESEVLSLHLLAGELRLNKAGAETMSDRE
PQLSMALSQEGELEMRDLDSTLNIFPEEQISKASNTVPGLEEWISSQQRPVPAAVVPMVENALDAVTPMPGEDIPAVALTASEGPAANASASDGTAAATPIVPIPEEDIP
GASVVILVEDVMTAAISAPEQAAASSGAVPPVETVTVPIIDEDVTSEEPDTQAAEMFLPEEPAIPTPAGPTAEEPDTPTVPVSTAEEPSMPPPAGPTPEESAAPTLKEPT
PEKPDTQVVSSSIPEWSATPATAVPAKEIFSPDGPFLEGTTHTDSVPISEETPVLENASSPGMGIKECLDSSAFGIKEVPGTMIHGKVPLAATDGLNSHEVIVDHFIGRK
GLEHKVRIASSLTWC*
4 >lcl|NP_032837.1|Plus1complement(9747098..9748273) NT_166285 pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial precursor Pdha2 __SEG__ Chr3 {Mus musculus} MRKMLTAVLSHVFSGMVQKPALRGLLSSLKFSNDATCDIKKCDLYRLEEGPPTSTVLTRAEALKYYRTMQVIRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGIN
PTDHVITSYRAHGFCYTRGLSVKSILAELTGRKGGCAKGKGGSMHMYGKNFYGGNGIVGAQVPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYNMSALWKLPCV
FICENNLYGMGTSNERSAASTDYHKKGFIIPGLRVNGMDILCVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGISYRSREEVHNVRSKSDPIMLLRERIISNNL
SNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS*
5 >lcl|NP_058035.1|Plus11454560..1454886 NT_039614 ATP synthase-coupling factor 6, mitochondrial precursor Atp5j __SEG__ Chr14 {Mus musculus} MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDIGPEYQQDLDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS*
6 >lcl|NP_071316.1|Plus1complement(914362..915924) NT_109317 succinyl-CoA:3-ketoacid-coenzyme A transferase 2A, mitochondrial precursor Oxct2a __SEG__ Chr4 {Mus musculus} MAALRLLAWALPRGVSALRPPPALPHRLIRRYVSDRSGSVHFYTDPVKAVEGVKDGSTVMLGGFGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGILLASKQVRR
VVCSYLGENALCEKLYLAGELELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTLVQEGGSPIRYAPDGHLITLSEPREVREFQGRFYLLEHAIRADFALIKGWKADRSGN
VIFRGSARNFNVPMCKAADISVVEVEEIVDVGTFAPEDIHVPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDPSRTRIIKRAALEFQDGMYANLGIGIPVLASNY
ISPKMTVYLHSENGILGLGPFPLKNEVDADVINAGKQTVTVVPGGCFFASDDSFAMIRGGHLQLTMLGAMQVSQYGDLANWMVPGKKVKGMGGAMDLVSSKKTRVVVTME
HCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSKGLTLVELWEGSSVDDIKATTACSFAVSPNLKPMQQIKLDA*
7 >lcl|NP_082221.2|Plus1complement(41551822..41553222) NT_039500 citrate synthase-like protein Csl __SEG__ Chr10 {Mus musculus} MALLTAAAWFLGTKNPPCLVLAARHASASSTNLKDVLRNLIPKEQARIKTFRKKHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKLLPKAKG
GKEPLPEGLFWLLVTGQMPTEEQVSWLSQEWVKRAALPSHVVTMLDNFPTKLHPMSQLSAAITVLNNESNFARAYAQGMNRTKYWELTYEDCMDLLAKLPCVAAKIYRNL
YREDRNIEAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAALNGLAGPLHGLANQEVLVWLTQLQKEVGEDASDEKLKN
YIWNTLNSGRVVPGYGHAVLRKTDPRYSCQREFALKHLPKDPMFKLVGQLYKIVPDILLEQGKAKNPWPNVDAHSGVLLQYYGMREMNYYTVLFGVSRALGVLSQLIWSR
ALGFPLERPKSMSTDALMKFVNSESG*
8 >lcl|NP_082546.1|Plus13654411..3655970 NT_109315 aldehyde dehydrogenase X, mitochondrial precursor Aldh1b1 __SEG__ Chr4 {Mus musculus} MLTARLLLPRLLCLQGRTTSYSTAAALPNPIPNPEICYNKLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRL
ADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSA
LYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGESNLKRVTLELGGKSPSIVLADADMEHAVDQCHEALFFNMGQCCCAGSRTFVE
ESIYREFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQDGMRIAKEEIFGPVQPLFKFKKIEEVIQRAN
NTRYGLAAAVFTRDLDKAIYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPEKNS*
9 >lcl|NP_083397.3|Plus1complement(73537414..73538094) NT_039649 V-type proton ATPase subunit E 2 Atp6v1e2 __SEG__ Chr17 {Mus musculus} MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEE
IYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNT
SRKFFT*
10 >lcl|NP_780558.1|Plus1complement(2417509..2418657) NT_039636 L-lactate dehydrogenase A-like 6B Ldhal6b __SEG__ Chr17 {Mus musculus} MAWATSILRASRRVSTTRVDFKGFGIALWPSQVQRVPPNRAWWSLTPTSSMATVKGELIQHISSEEPVLHNKVSIVGTGSVGMACAIGIIAKGLTDELALVDNNEEKMKG
ETMDLQHGSVFMKMPNIVCSKDFRVTANSEVVIITAGARQEKNETRLNLVQRNVTIFKAMVAEIIKHSPRCKIIVVSNPVDILTFVTWKLSGFPKNRIIGSGCNLDTARF
RYMLGQRLGIHSESCHGWVLGEHGDSSVPVWSGVNIAGVPLRELNSAIGTSKDPEKWGDVHKEVIASAYNIIKMKGYTSWAIGLSVTDIAESILKNLRKTHPVTTKIQGL
YGIKEEVFLSVPCILGESGISDIIKVKLSPTEEAQMVKSAETIWKIQKDIKF*
11 >lcl|NP_862907.2|Plus1708627..710189 NT_109317 succinyl-CoA:3-ketoacid-coenzyme A transferase 2B, mitochondrial precursor Oxct2b __SEG__ Chr4 {Mus musculus} MAALRLLAWALPRGVSALRPRPALPHRLIRRYVSDRSGSVHFYTDPVKAVEGVKDGSTVMLGGFGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGILLASKQVRR
VVCSYLGENALCEKLYLAGELELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTLVQEGGSPIRYAPDGHLITLSEPREVREFQGRFYLLEHAIRADFALIKGWKADRSGN
VIFRGSARNFNVPMCKAADISVVEVEEIVDVGTFAPEDIHIPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDPSRTRIIKRAALEFQDGMYANLGIGIPVLASNY
ISPKMTVYLHSENGILGLGPFPLKNEVDADVINAGKQTVTVVPGGCFFASDDSFAMIRGGHLQLTMLGAMQVSQYGDLANWMVPGKKVKGMGGAMDLVSSKKTRVVVTME
HCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSKGLTLVELWEGSSVDDIKATTACSFAVSPNLKPMQQIKLDA*
12 >lcl|XP_001472331.2|Plus1complement(6112..6552) NT_166327 ATP synthase lipid-binding protein, mitochondrial-like LOC100039108 __SEG__ Chr17 {Mus musculus} MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDESLSSLAVRRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARN
PSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM*
13 >lcl|XP_001477313.1|Plus111628777..11628968 NT_039606 cytochrome c oxidase subunit 7C, mitochondrial-like isoform 2 Gm3386 __SEG__ Chr14 {Mus musculus} MLGQSIRRFTTSVVRRSHYEEGQGKNLPFSVENKWRLLAMMTVYFGSGFAAPFFIVRRQLLKK*
14 >lcl|XP_001478454.1|Plus118062138..18062455 NT_039687 cytochrome c, somatic-like isoform 2 Gm10053 __SEG__ Chr19 {Mus musculus} MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE*
15 >lcl|XP_001478505.1|Plus1complement(8974703..8975014) NT_165760 ATP synthase subunit g, mitochondrial-like Gm10221 __SEG__ Chr5 {Mus musculus} MAKFIRNFAEKAPSMVAAAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQSVKKIIQSAKTGSFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV*
16 >lcl|XP_001480523.1|Plus1complement(597426..597896) NT_166306 acyl carrier protein, mitochondrial-like Gm4459 __SEG__ Chr7 {Mus musculus} MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPEALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGL
DSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE*
17 >lcl|XP_003084509.1|Plus1complement(14756567..14756902) NT_039185 cytochrome b-c1 complex subunit 7-like LOC100504052 __SEG__ Chr1 {Mus musculus} MAGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLQETEDVKEAIRRLPEDLYNDRIFRIKRALDLTMMHQILPKDPWTKYEEDKFYLEPYLKEVIRERKEREEWAK
K*
18 >lcl|XP_003084720.1|Plus1complement(21731811..21732251) NT_039413 ATP synthase lipid-binding protein, mitochondrial-like Gm10175 __SEG__ Chr7 {Mus musculus} MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDESLSSLAVRRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARN
PSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM*
19 >lcl|XP_003084723.1|Plus126319791..26320111 NT_039413 cytochrome c, somatic-like LOC100503763 __SEG__ Chr7 {Mus musculus} MGDVEKGKKIFVQRCAQCHTVRKGGKHKTGPNLQGLFGQKTGQAAGFSYTDASKNRGITWGEDTLLDGVFRESQKYIPGTKMIFAGIKKTGEKKDLIAYLKKAANE*
20 >lcl|XP_003084886.1|Plus1complement(38202868..38203059) NT_039500 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100504157 __SEG__ Chr10 {Mus musculus} MLGQSIRRFTTTMVCRSHYEEDPGKNLPFSVENKWRLLAMMILYFGSGLAAPFFIVRHQLLKK*
21 >lcl|XP_003084937.1|Plus122967460..22967801 NT_039548 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5-like LOC100502727 __SEG__ Chr12 {Mus musculus} MVSLLKKTTGLVGLAVCDSPHERLTILYAQVLHLLKHFPKHAVYRKHMEQITNEKLDMVKAEPDVKKLEDVLQGGEIEEVILQTENELSLARKMLQRKPWKPLEEEPPAN
QKK*
22 >lcl|XP_003085253.1|Plus1complement(61359869..61360168) NT_039674 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-like LOC100503391 __SEG__ Chr18 {Mus musculus} MTAGHGHRHGHGHGKVELPDYRWWKTEGAPLEMMMKKLAAGRLRDPWACNESWRYMGSFASNATFPSVILKGFKWGFAAFVAALGAEYFLASQNDDKHH*
23 >lcl|XP_891680.1|Plus1complement(2415565..2415759) NT_082868 cytochrome b-c1 complex subunit 9-like Gm6293 __SEG__ Chr19 {Mus musculus} MSLPTIPSRLYSLLFRRTSTFALTIAVGALFFERALDQGADAIYEHINEGKLWKHIKFLYENKE*
24 >lcl|XP_894449.1|Plus1complement(23711149..23711940) NT_096135 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial-like Gm12251 __SEG__ Chr11 {Mus musculus} MAAATARVCCRGLLGAASVGRGAGRPSVLWQHVRRESTAADKRPTVRPWSDVTHKQLSAFAEYVAEILPKYVQQVQVSCLDKLEICIHHDGVIPTLTFLRDHTNAQFKSL
ADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFPLAGYVELRYDDEVKRVVA
EPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPETK*
25 >lcl|XP_894909.1|Plus1complement(21304074..21304424) NT_039428 NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like Gm6415 __SEG__ Chr7 {Mus musculus} MAVVLTFRWLLTLPRAARGFRVRVLPSGEKITHTGQVYDEKDYRRIRFVDRQKEVNENFAIDLIAQQPVNEVDHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQ
FKQHHH*
26 >lcl|XP_904967.1|Plus115123765..15124769 NT_039687 l-lactate dehydrogenase B chain-like isoform 7 Gm5514 __SEG__ Chr19 {Mus musculus} MATLKEKLIASVAEDEAAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKEEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVSAGVRQQEGESRLNL
VQRNVNVFKFIIPQIVKYSPDCTIIVVSNPVDILTYVTWKLRGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMG
TDNDSENWKEVHKMVVVSAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLRKSADTLWDIQKD
LKDL*