SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul C    

ID / Description / Sequence
1 >lcl|NP_001029373.1|Plus1complement(8327455..8327730) NW_001118155 ubiquinol-cytochrome c reductase hinge protein UQCRH __SEG__ Chr5 {Macaca mulatta} MGLEDERKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELLDFLHARDHCVAHKLFNNLK*
2 >lcl|XP_001081984.2|Plus1complement(101524..101715) NW_001099001 cytochrome c oxidase subunit 7C, mitochondrial-like LOC693275 __SEG__ Chr13 {Macaca mulatta} MLGHSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWALLVKMCLFFGSAFSVPFLIVRHQLLKQ*
3 >lcl|XP_001081996.1|Plus1complement(1576350..1577354) NW_001105686 l-lactate dehydrogenase B chain LDHB __SEG__ Chr18 {Macaca mulatta} MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGKMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNL
VQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMG
TDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
LKDL*
4 >lcl|XP_001082646.2|Plus1386039..386614 NW_001114274 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial-like LOC693813 __SEG__ Chr3 {Macaca mulatta} MKKVKMAVARAGVLGVQWLQRESRNVVLLGAQPASRITKDLFPGLYPRTPEELAAAAKKYIMRVEDYQRYPDEGMGYGDYPKLPDRSQHEKDPWYSWDQPDLRLNWGEPM
HWHLDMYTRNRVDTSPTPVSWNVMCMQLFGFLAFMTFMFWAGDMYPVYQPVGPKQYPYNNLYLERGGDPSKEPEPVVHYEI*
5 >lcl|XP_001082964.2|Plus11944209..1944625 NW_001112558 ATP synthase lipid-binding protein, mitochondrial ATP5G1 __SEG__ Chr2 {Macaca mulatta} MQTTGALFISPAQIHCCTRGLIRPVSASFLNSPENSSKQPFYSSSQLQVARQEFQTTVVVSWDIDTATKFIGAEAATVGVAGSVAGIGIVFGSLIIGYARNPSLRQ*LFS
YAILGFTLSEAMGGLFCLMVTFHILFTV*
6 >lcl|XP_001083095.1|Plus1complement(22800..23120) NW_001108822 NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 isoform 1 NDUFS5 __SEG__ Chr1 {Macaca mulatta} MPFLDIQKRFGLNIDRWWTIQSAEQPYKLATRCHAFEKEWIECAHGIGAIRAEKECKIEYDDFVECLLRQKTMRRAGAIRRQRDKLIKEGKYTPPPHHIGKEEPRP*
7 >lcl|XP_001083200.1|Plus11290394..1290732 NW_001112538 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 NDUFA5 __SEG__ Chr2 {Macaca mulatta} MANVLKTTGIAVCKSPHERLRIFYTNIRDVLEQIPKNAAYRKYTEQITNEKLAMVKVESDVQKLEDQLEGGQIKEIILLGKNELSLARQMMQWKTWKPLVEEPPAHQWKW
PV*
8 >lcl|XP_001083453.1|Plus1345510..345791 NW_001121210 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-like LOC694795 __SEG__ Chr7 {Macaca mulatta} MAHEHGHSKMELPDCKQWKIEGTPLETVKKKLAARGLRDPWGRDEAWRYVSGFANNGSSTGALLQGFKWGFAAFVGAVGAEYYLESLNKDKHH*
9 >lcl|XP_001085135.1|Plus1complement(2277333..2277650) NW_001116512 cytochrome c-like LOC694977 __SEG__ Chr4 {Macaca mulatta} MGDVEKGKKIFVMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSNTAANKNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKREERADLIAYLKKATNE*
10 >lcl|XP_001085541.1|Plus1complement(21181..22275) NW_001122913 l-lactate dehydrogenase B chain LDHB __SEG__ Chr8 {Macaca mulatta} MNRVRKETKRHCVLRTAVTEVSSAFSLLCKMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVA
DKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWI
LGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL*
11 >lcl|XP_001085565.1|Plus11223748..1224128 NW_001098993 cytochrome b-c1 complex subunit 6, mitochondrial UQCRH __SEG__ Chr13 {Macaca mulatta} MGLEDERKMLTESRDTKEEEEEEEELVFLHQDPLTTVREQCEQLEKCVKAQERLELCDEHVCSQSHTEEDCTEELFDFLHARDHCVAHKLFNNLKYIYGLIHPSLHHLGI
RIFPYGFGYAICFLFV*
12 >lcl|XP_001085732.1|Plus17058685..7058933 NW_001118159 cytochrome b-c1 complex subunit 8 UQCRQ __SEG__ Chr5 {Macaca mulatta} MGREFGNRRQMLHVISYSLSLFEQRALPHYFTKGIPNVLRRTQEPFLRIMPPFIAFYLIYTWGTQEFKRSKGKNPAAYENDR*
13 >lcl|XP_001086288.1|Plus1complement(1694094..1694519) NW_001121154 ATP synthase lipid-binding protein, mitochondrial ATP5G3 __SEG__ Chr7 {Macaca mulatta} MFACAKLACTPALIRAGSRVAYRPISASVLSRPEARTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQ
QLFSYAILGFALSEAMGLFCLMVAFLILFAM*
14 >lcl|XP_001086967.1|Plus17352487..7353485 NW_001104501 l-lactate dehydrogenase A chain isoform 3 LDHA __SEG__ Chr17 {Macaca mulatta} MATLKDQLIHNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLV
QRNVNIFKFIVPNVVKYSPNCKLLIVSNPVDSLTYVAWKISGFPKNRVIGSGCNVDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGT
DKDKEQWKEVHKQVVESAYEVIKLKGYTSWATGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTPEEEARLKKSADTLWGIQKEL
QF*
15 >lcl|XP_001087042.1|Plus1complement(4970550..4970903) NW_001116512 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5-like LOC698545 __SEG__ Chr4 {Macaca mulatta} MGQGVPKKTTGPVGLAACENPHERLRILYTKILDVLEQISKNAAYKKCTEQITNERLAMLKVEPDVKKLEDQLQGGQIEEGIHQAENELSLVRKTMQWKPWEALVEEPPA
NQWKEPI*
16 >lcl|XP_001087216.1|Plus12079690..2080004 NW_001112544 cytochrome c-like LOC695875 __SEG__ Chr2 {Macaca mulatta} MGDVEKGKKIFVKKCAQCHTVEKGGKHKTGPNLHGLFARKTGQAIGFSYTDAKKNKGITWGQDKLMEYLENPKKYIPGRKTIFAGIKKAERADLIGYLKKVTNE*
17 >lcl|XP_001088363.1|Plus1complement(4508425..4508736) NW_001100377 ATP synthase subunit g, mitochondrial-like LOC698075 __SEG__ Chr14 {Macaca mulatta} MAQFVRNLVEKTLALVNAAVTYSKPQLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKHGIIGYDV*
18 >lcl|XP_001088492.1|Plus1complement(5331283..5331600) NW_001105681 cytochrome c-like LOC698225 __SEG__ Chr18 {Macaca mulatta} MGNVEKGKKIFTMKCSQCHTVEKGGKHQTGPNLHGLFGRKTVQAPGYSYTAANENKGITWGEDTLMEYLENPKKCLPGTKMIFVGIKKKEERADLIAYLKEATNE*
19 >lcl|XP_001088523.1|Plus1complement(2564227..2564493) NW_001121210 ATP synthase subunit f, mitochondrial-like isoform 2 LOC696890 __SEG__ Chr7 {Macaca mulatta} MASVVPVKDKKLLEVKLGELPKWILMRDFSPSGILGAFRRGYYRYYNKYINVKKGRISGITMVLTCYVVFNYSISYKHLKHERLRKYH*
20 >lcl|XP_001088617.1|Plus1812056..812523 NW_001116507 v-type proton ATPase 16 kDa proteolipid subunit ATP6V0C __SEG__ Chr4 {Macaca mulatta} MSESNNRPEYASFFAVMGASAAMVCSAPRAAYGTVKSRAGIAAMSVMRPELIMKSIVPVVMAGIIAIYGLVVAVLIASSLNDDISLYRSSLQLSAGLRVGPSGLAAGFAV
GIVRNAGVRATAQQPRLFMGMILTLIFAEVLGLYGLIVALIHSTE*
21 >lcl|XP_001088930.1|Plus11466611..1466928 NW_001104429 cytochrome c-like LOC705449 __SEG__ Chr17 {Macaca mulatta} MGDVEKGKKIFVQKCAQCHTVETGGKHKTGPNLHGLIGWKTGQAIGFSYIDTGKNKGITWGNDTLREYLENPRKYVPGTKMIFAGIKKTAERADLLAYLKKATSE*
22 >lcl|XP_001089360.1|Plus1complement(1946936..1947202) NW_001109259 ATP synthase subunit f, mitochondrial-like isoform 2 LOC704076 __SEG__ Chr1 {Macaca mulatta} MASVVPVKDKKLLEVKLGELPSWILMRDFSPSGILGAFRRGYYRYYNKYVNVRKGSISGITMVLACYVLFNYCISYKHLKHERLRKYH*
23 >lcl|XP_001089569.2|Plus1complement(3791915..3792229) NW_001100380 cytochrome c-like LOC701246 __SEG__ Chr14 {Macaca mulatta} MGDVEKGKKIFIMKCSQCHTVEKGGKHKTEPNLHGLFGRKTGQARGYSYTAASKNKGITWGEDTLMKYLENPKKYIPGTKMIFVGIKKEERADLIAYLKKATNE*
24 >lcl|XP_001089946.1|Plus11575712..1576068 NW_001095158 v-type proton ATPase subunit G 1-like LOC699066 __SEG__ Chr10 {Macaca mulatta} MTSQLQGIQQLLKAEKWATEKVSEAHRQKNQRLKQVKEAAQAEIEQCYLQRKKEFKAKEAAALGSHGRCSTEVDKETQDKMAILQTYFQQNREEVVNNFLAFVCDIQPEI
HENYCLDG*
25 >lcl|XP_001090451.1|Plus1complement(5544167..5544565) NW_001116512 acylphosphatase-1 ACYP1 __SEG__ Chr4 {Macaca mulatta} MAEGDTLISVDYEIFGKVQGVFFHKHTQAEGKKLGLVGWVQNADRSTVQGQLQGPIFKEHHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVKEWPEFKFSKIN
SVVWFFLLIEIELLCVNISISQ*
26 >lcl|XP_001090573.1|Plus1complement(146417..146902) NW_001118161 ATP synthase subunit d, mitochondrial-like LOC699117 __SEG__ Chr5 {Macaca mulatta} MAGQKLALKTIDWVAFVEIIPQNQKAIASSPKSWNETLTSRLAALPENPPAIDWAYYKANVAKASLVDDFEKKFNALKIPMPEDKYTAQVDAKEKEDVKSCAEWVSLSKA
RIVEYEKQIEKIKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL*
27 >lcl|XP_001090805.1|Plus19823055..9823411 NW_001116517 v-type proton ATPase subunit G 1-like LOC698616 __SEG__ Chr4 {Macaca mulatta} MASQSQGIQQPLLAEKRAAEKVSEARERKNRRLKQAKEAAQAEIEQYRLQREKEFKAKEAAALGSHGSCRTEVEEETQEKMTILHTCFQQSRDEVLDNLLAFVCDIRPES
HENYRING*
28 >lcl|XP_001091043.1|Plus11446008..1447861 NW_001118147 v-type proton ATPase catalytic subunit A-like LOC696878 __SEG__ Chr5 {Macaca mulatta} MDFSKLPKILDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDIS
SQTQSIYIPRGVNVSALSRDIKWDFTPCKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFTMVQVWPVRQVRPVTEK
LPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALAANTSNMPVAAREASIYTG
ITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLA
QRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDM
ARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED*
29 >lcl|XP_001091520.1|Plus1253671..255260 NW_001114269 ATP synthase subunit beta, mitochondrial ATP5B __SEG__ Chr3 {Macaca mulatta} MLGLVGSVATASASGALRGLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRT
IAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPFDERGPIKTKQFAAIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELI
NNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVG
YQPTLTTDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAI
LGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHAS*
30 >lcl|XP_001091573.2|Plus12923468..2924415 NW_001121194 olfactory receptor 11H7-like LOC703276 __SEG__ Chr7 {Macaca mulatta} MNNSQISTVTQFALLGFPGPWKIRIIFFSMILLVYILTLTGNMAIICAVRWDHRLYTPMYMLLANFSFLEIWYVTCTVPKMLVNFFSKTKTISFSGCFTQFYFFFSLGTT
ECFFLCVMAYDRYLAICHPLHYPSIMTDQLCGILVSLCWLIGFLGHSISIFSISQLPFCGPNIIDHFLCDVDPLMALSCAPTHTIGHVFHSLSSLFIILTMVYILGSYTL
VLRTVLQVPSSAGWQKAFSTCGSHLVVVSLFYGTIMVMYVSPTPGNSVAMHKIITLIYSVVTPVLNPLIYSLRNKDMKYALHHVFCGRELSRAHE*
31 >lcl|XP_001091594.1|Plus1complement(1956916..1957557) NW_001098157 ATP synthase subunit O, mitochondrial ATP5O __SEG__ Chr12 {Macaca mulatta} MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYSIEGRYATALYSAASKQSKLEEVEKELLRVAQILKEPKVAASVLNPYVKRSVRVKSLKDITAKERFSPVTTNWIN
VLAENGRLSNTQGVVSAFFTMMSVHRGEVPCTVTTASPLEEAILSELKTVLKSFVSQGQVLKLEAKTDLSITGGMTVRIGEKYVGTSVKTKIQKLGRAMWEVV*
32 >lcl|XP_001092357.1|Plus1complement(1811406..1812311) NW_001120986 mitochondrial ornithine transporter 2 SLC25A2 __SEG__ Chr6 {Macaca mulatta} MKSSPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYTQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTA
TAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFYFGGYELSRSFFASGRSKDELGPVHLMLSGGVAG
ICLWLVVFPVDCIKSRIQVLSMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMSQLEAY*
33 >lcl|XP_001093714.2|Plus1168550..168741 NW_001116478 cytochrome c oxidase subunit 7C, mitochondrial-like LOC702058 __SEG__ Chr4 {Macaca mulatta} MLGQSIRRFATSVVRRSHYEEGPGKNLPFSVENKWALLVKMCLYFGSTFAAPFLIVRHRLLKS*
34 >lcl|XP_001093794.1|Plus1complement(8877009..8877488) NW_001098990 succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial SDHD __SEG__ Chr13 {Macaca mulatta} MAVVWRLSALCGAQGGRALLLRTPVVRPAHISAFLQDRPIPEWRGVQHIHLSPRHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQV
VTDYVHGDASQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL*
35 >lcl|XP_001093802.1|Plus1complement(4751564..4751881) NW_001101665 cytochrome c-like LOC699951 __SEG__ Chr15 {Macaca mulatta} MGDVEKGKKIFIMKCSQCHTIEKGSKHKIGPNLHGLFGRKTGQAPGCSYTAANKNKGNTWGEDTLIEYLENPKKYIPGTKMICVGIKKKEERADLIAYLKKTTND*
36 >lcl|XP_001093831.1|Plus13584773..3585543 NW_001118161 ATP synthase subunit b, mitochondrial ATP5F1 __SEG__ Chr5 {Macaca mulatta} MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLAPLPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVITAETFTAMSLIGIMV
YGIKKYGPFVAAYADKINEQKLAQLEEAKQSSIQQIQNAIDMEKSQQALTQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKSRLDYHIAVQNMTRRKEQEHMINWVE
KHVVQSISAEQEKETVAKCIADLKLLAKKAQAPLVM*
37 >lcl|XP_001094441.2|Plus1complement(659506..659838) NW_001218125 cytochrome b-c1 complex subunit 7 UQCRB __SEG__ ChrX {Macaca mulatta} MAGKQAISASGKWLDRIQKWYYNAAGFNKLRLMRDDTIYEDEDVKQAIRRLPENLYNDRMFHIKRALDLTMKHQILPKEQ*TKYEEENFYLELYLKEVIWERKERRMGKE
V
38 >lcl|XP_001094984.1|Plus16744233..6744529 NW_001099001 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-like LOC699693 __SEG__ Chr13 {Macaca mulatta} MAHGHGREHGHHKMELPDYRQWKIEGAPLEDIQKKLAAKGVRDPWGRNEVWRYMGGFAKSVSFFDVFFKGFKWGFAAFVVAVGAEYYLNSLNKDKKHH*
39 >lcl|XP_001096979.1|Plus12355326..2355601 NW_001101659 cytochrome b-c1 complex subunit 6, mitochondrial isoform 2 UQCRH __SEG__ Chr15 {Macaca mulatta} MGLEDERKMLPESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELLDFLYARDHCMAHKLFNNLK*
40 >lcl|XP_001098184.1|Plus1129311..129721 NW_001096638 ATP synthase lipid-binding protein, mitochondrial ATP5G1 __SEG__ Chr11 {Macaca mulatta} MQTPGAPLISLALIHCGTRGLIRLVSASLLNSPENSSKQPSYGSCLLQVATCEFQISVVSWDADTAAKFVGVGAATVGVRGSGAGIGMVFGSLIIGYARNLSLKQQLFFC
AIRGFALSEVMGLFCLMVSFLIVFAM*
41 >lcl|XP_001098186.1|Plus1complement(12151105..12151371) NW_001098159 ATP synthase subunit f, mitochondrial-like isoform 2 LOC702581 __SEG__ Chr12 {Macaca mulatta} MASVVPVKDKKLLEVKLGELPSWILMRDFSPSGILGAFQRGYYRYYNKYINMKKGSISGITMVLACYMLFNYSISYKHLKHERLRKYH*
42 >lcl|XP_001098379.2|Plus11515572..1515763 NW_001110969 cytochrome c oxidase subunit 7C, mitochondrial-like LOC706698 __SEG__ Chr1 {Macaca mulatta} MLGHSIRKFTTSVVHRSHYEEGPGKYSPFSVENKWALLVKMCLYFGSAFAAPFLIVQHQLLKS*
43 >lcl|XP_001098727.1|Plus13745832..3746977 NW_001121156 l-lactate dehydrogenase A-like 6B-like LOC702403 __SEG__ Chr7 {Macaca mulatta} MSWTVPLVRASQRVSSVGANFLCLKMALCPRQAARIPLKGAWRFTSVSKMATVKSELIERFTSEEPVHHSKVSIIGTGSVGMACAISILLKGLIDELALVDVDEGKLKGE
TMDLQHGSSFTKMPNIVCSKDYIVTANSNLVIITAGARQEKGETRLNLVQRNVALFKLMISNIVQHSPHCKLIIVSNPVDILSYVAWKLSAFPKNRVIGSGCNLDTARFR
FLIGQKLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHEEVIATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRTHPVSTIIKGLY
GIDEEVFLSIPCILGENGITHLIKIKLTPEEEDRLKKSAKTLWEIQKELKI*
44 >lcl|XP_001098868.1|Plus13409670..3410080 NW_001120988 cytochrome c oxidase subunit 5B, mitochondrial-like LOC710274 __SEG__ Chr6 {Macaca mulatta} MISVEDARASRLLRGAGALAAQALRARGPSGVAVVRSMASGGGVPTDDEQATGLEREVMLAARKGLDPYNILPPKGASGTKEDPNLVPSITNKRIVGCICEEDNTSVVWF
WLHEGEAQRCPRCGAHYKLVPHRLAH*
45 >lcl|XP_001098906.1|Plus1complement(206652..207062) NW_001106349 ATP synthase lipid-binding protein, mitochondrial ATP5G1 __SEG__ Chr19 {Macaca mulatta} MQTTRALLLSPALIRCCTRGLTRPVSASFLNSSVNSSKQPSYSSFPLQVARWEFQTSVASRDIDTAAKLIGAGAARVGVAGSGAGIGMVLGSLIIGYARNLSVKQQLFFC
AILGFALSDVVGLFCLTVAFLILFTM*
46 >lcl|XP_001099796.1|Plus11450000..1450425 NW_001108727 ATP synthase lipid-binding protein, mitochondrial isoform 1 ATP5G3 __SEG__ Chr1 {Macaca mulatta} MFACAKLACTPALIRAGSRVAYRPISASVLSRPEARTGEGSTVFNGAQNGVSQLIQREFQTSVISRDIDTAAEFTGAGAATVGVAGSGAGIGTVFGSLIIGCARNPSLKQ
QLFSYAILGFALSEAMGLFCLMVAFLIVFAM*
47 >lcl|XP_001099839.1|Plus1complement(1960002..1960310) NW_001111321 cytochrome c-like LOC702488 __SEG__ Chr20 {Macaca mulatta} MGAVEKGKKIFVQKCAQCHTIEKGGKHKTGPNLFGRKTGQAVGFSHTDASKNKGITWGEDALMQYLKNPKKYISGTKMIFAGIKKEAERADLRAYLKKATNE*
48 >lcl|XP_001099921.1|Plus1692394..692783 NW_001100395 cytochrome c oxidase subunit 5B, mitochondrial-like isoform 2 LOC701661 __SEG__ Chr14 {Macaca mulatta} MASRLLRGAGALAAQALRARGPSGVAAVRSMASGGGIPTDDEQATGLEREVMLAARKGLDPYNILPPKGASGTKEDPNLVPSITNKRIVGCICEEDNTSVVWFWLHEGEA
QRCPRCGAHYKLVPHRLAH*
49 >lcl|XP_001101289.1|Plus1complement(29869..30693) NW_001096657 cytochrome b-c1 complex subunit Rieske, mitochondrial isoform 2 UQCRFS1 __SEG__ Chr11 {Macaca mulatta} MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPKPPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPASVCYSHTDVKVPDFYDYRRLEVLDSTKSSRESSEAR
KGFSYLVTAVTTVGVAYAAKNVVTQFISTMSASADVLAMAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHL
GCVPIANAGDFGGFYCPCHGSHYDASGRIRLGPAPLNLEVPPYEFTSDDMVVVG*
50 >lcl|XP_001102691.1|Plus12600832..2601098 NW_001112571 ATP synthase subunit f, mitochondrial-like isoform 2 LOC704440 __SEG__ Chr2 {Macaca mulatta} MASVIPVKDKKLLEVKLGELPSWILMRDFSPSGILGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFNYSISYKHLKHERLRKYH*
51 >lcl|XP_001102823.1|Plus1complement(11232970..11234796) NW_001120965 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like LOC713467 __SEG__ Chr6 {Macaca mulatta} MDVLKNIHPTTGYGGVRVLCGWTPSSGATPRNRLLLQLLGSPGRRCYSLPPHQKVPLPSLSPTMQSGTIAHWEKKEGGKINEGDLIAEVETDKATVGFESLEECYMAKIL
VAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAAPTPQAAPAPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDK
ATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVATVPLTPQPLAPTPSAPCPATPAGPKGRVFVSPLAKKLAVEKG
IDLTQVKGTGPDGRVTKKDIDSFVPSKAAPAPAAVVPPTGPGMAPVPTDVFTDIPISNVHQVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVQKELNKILEGRSKISVNDF
IIKASALACLKVPEANSSWMDTVMRQNHIVDISVAVSTPIGLITPIVFNAHIKGLETITNDVVSLATKAREGKLQPHEFQGGTFTISNLGLFGIKNFSAIINLLQACILA
IGASEDKLVPTDNEKGFDVASMMSVTLSCDHQVVDGAVRDQWLAEFRKYLEKPITMLL*
52 >lcl|XP_001103900.1|Plus1complement(2841754..2842119) NW_001106534 ATP synthase subunit g, mitochondrial-like LOC714250 __SEG__ Chr19 {Macaca mulatta} KRKNLYRPFGATEFSSQSHGQFVRNLVEKTPALANAVVTYSKPQLATFWYYAKVELVPPTPAEIPTAVQSLKKIVISAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEI
IGKCGIIDYDV*
53 >lcl|XP_001104174.1|Plus14803616..4803879 NW_001095180 ATP synthase subunit f, mitochondrial-like LOC707114 __SEG__ Chr10 {Macaca mulatta} MASVISVKDKKLLEVKLGELPSWILMQDFSPSGIFRAFQRGYYWYYKYIDVRKGSISGVTMVLACYVLFSYCLSYKHLKRERLRKYY*
54 >lcl|XP_001104905.1|Plus1complement(18713941..18714348) NW_001118143 ATP synthase lipid-binding protein, mitochondrial ATP5G1 __SEG__ Chr5 {Macaca mulatta} MQTTGALLISPALIHCTRGLIRPVSASFLNSPVNSSKQPSYSSFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYA
ILGFALSEAMGLFCLMVAFLILFAM*
55 >lcl|XP_001106256.1|Plus12977273..2977539 NW_001114169 ATP synthase subunit f, mitochondrial-like isoform 2 LOC709495 __SEG__ Chr3 {Macaca mulatta} MASVVPVKDKKLLEVKLGELPNWILMRDFSPSGILGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFNYSISYKHLKHEWLRKYH*
56 >lcl|XP_001106593.1|Plus11304865..1305182 NW_001108937 cytochrome c-like LOC716056 __SEG__ Chr1 {Macaca mulatta} MGDVEKGKKIFVQKCAQCLTMEKGGKHKTGPNLHGLFGQKTGQAVGFSYTDANKNKRITWGEDTLMEYLENPKKYIPGTKMIFAGIKNKVEKADLTAYLKKATNE*
57 >lcl|XP_001106653.1|Plus1875971..876291 NW_001124220 NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 NDUFS5 __SEG__ Chr9 {Macaca mulatta} MPFLDIQKRFGLNIDRWWTIQSAEQPYKLATRCHAFEKEWIECAHGIGAIRAEKECKIEYDDFIECLLRQKTMRRVNAIRRQRDKLIKEGKYTPPPHHIGKGEPRP*
58 >lcl|XP_001107027.1|Plus17586541..7586852 NW_001114169 ATP synthase subunit g, mitochondrial-like LOC711183 __SEG__ Chr3 {Macaca mulatta} MAQFVRNLVEKTPALVNAAVTYLKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGVVATEVLMWFYVGEIIGKHGIIGYDV*
59 >lcl|XP_001108313.1|Plus1complement(10870817..10871566) NW_001096636 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial-like LOC713739 __SEG__ Chr11 {Macaca mulatta} MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPM
RVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLGNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRS
GRFSCEPAGGLTSLTEPPKGPGFGVQAGL*
60 >lcl|XP_001109609.1|Plus13121089..3121649 NW_001102965 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial-like LOC711899 __SEG__ Chr16 {Macaca mulatta} MAVARAGFLGIQWPQRASQNVVPLGAWTASRMTNDMLPASYPRTPEGRAATPKKYNMCVGDYEPYPDDGMRYGDYPKLPDCSQHERNPWYSWDQPDLRLNCGEPTHWHLD
MYTRNRVDMSPTPVSWNVTCMQLFSFMAFMTFMFWVGDMYPVYQPVGPKQYACNNLYLERGSDPSKEPESVVHYEI*
61 >lcl|XP_001110014.1|Plus1complement(5477133..5477399) NW_001098162 ATP synthase subunit f, mitochondrial-like LOC711636 __SEG__ Chr12 {Macaca mulatta} MASVLPVKDKKLLEVKLGELPSWILMRDFSPSGILGAFRRGYYRYYNKYINVRKGSISGITMVLACYVLFNYCLSYKHLKHERLRKYH*
62 >lcl|XP_001111766.1|Plus11703..2014 NW_001111538 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial-like LOC718711 __SEG__ Chr20 {Macaca mulatta} MAVARARVLGVQWLQRASRNVVPLGARTASRMPKDMLPGPYPRTPEERAAAAKKYNMRVEDYEPYPDEGMGYGDYPKLPDRSQHERDPWYSWDQPDLRLNWGEP
63 >lcl|XP_001111963.1|Plus117783..19399 NW_001100386 alpha-aminoadipic semialdehyde dehydrogenase-like isoform 2 LOC716090 __SEG__ Chr14 {Macaca mulatta} MWRLPRALCVHAAKTSKLPGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWGGREEVITTYCPANNEPIARVRQASVADYEETVKKAKEAWKIWADIPAPKR
GEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGA
PTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSSQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSARFAAVGTAGQRC
TTARRLFVHESIHDEVVNRLKKAYAQIRVGNPWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHDASIAHTETFAPILYVFKFKN
EEVFAWNDEVKQGLSSSIFTRDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGSESGSDAWKHYMRRSTCTINYSKDLPLAQGIKFQ*
64 >lcl|XP_001112108.1|Plus1complement(3611006..3612151) NW_001099002 creatine kinase B-type isoform 1 CKB __SEG__ Chr13 {Macaca mulatta} MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYDVFKDLFDPIIEDRHGGYKPSDEHKTDL
NPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHN
DNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFSEVLKRLRLQKRGTGGVDTAAV
GGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK*
65 >lcl|XP_001112404.1|Plus1complement(14207987..14208457) NW_001101663 acyl carrier protein, mitochondrial isoform 2 NDUFAB1 __SEG__ Chr15 {Macaca mulatta} MASRVLSAYVRRLPAAFAPLPRVPMLAVAQPLSTGLCSAGTQTRLGPLQPALRLAQVPGRVTQLCRQDSDMPPLTLEGIQDCVLYVLKLYDKIDPEKLSVDSHFMKDLGL
DGLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE*
66 >lcl|XP_001112592.1|Plus1954408..954671 NW_001102932 cytochrome c oxidase subunit 6B1-like LOC717143 __SEG__ Chr16 {Macaca mulatta} MAEEDIETKSKNYKTAPFDSRFPNQNQTRNCWQNYLDFHHCQKAMTAKGGAISVCEWYQCVYQSLCPTSWVIDWDDQRAEGTFPGKI*
67 >lcl|XP_001113068.1|Plus1complement(7936132..7936812) NW_001099000 v-type proton ATPase subunit E 2-like isoform 2 LOC714746 __SEG__ Chr13 {Macaca mulatta} MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSTMRNQARLKVLRARDDLISDLLSEAKLRLSRIVENPE
VYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDQEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKEKMPEIRMALFGANA
NRKFFI*
68 >lcl|XP_001113286.1|Plus15143173..5143430 NW_001099003 NADH-ubiquinone oxidoreductase chain 1-like LOC712403 __SEG__ Chr13 {Macaca mulatta} MTTVNLLLIIIPTLAAIAFLTLVERKLLGYMQLRKGPNVVGPYGLLQPFADAGKLFTKEPLKPSTSTTTLYIIAPALAFFITLLL*
69 >lcl|XP_001113376.1|Plus18520110..8520406 NW_001099000 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-like LOC715216 __SEG__ Chr13 {Macaca mulatta} MAHGHGHEHGHHKMELPDYRQWKIEGTPLEDIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFFDVFFKGFKWGFAAFVVAVGAEYYLNSLNKDKKHH*
70 >lcl|XP_001113489.1|Plus12074293..2074559 NW_001102932 ATP synthase subunit f, mitochondrial-like isoform 3 LOC717699 __SEG__ Chr16 {Macaca mulatta} MASVVPVKDKKLLEVKLGELPNWISMRDFSPSGILGAFRRGYYQYYNKYINVKKGSISGITMVLACYVLFNYSISYKHLKHERLRKYH*
71 >lcl|XP_001113547.1|Plus1complement(10635942..10636451) NW_001100395 cytochrome c oxidase subunit 4 isoform 1, mitochondrial-like isoform 2 LOC714951 __SEG__ Chr14 {Macaca mulatta} MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYVDRRDYPLPDVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRRWNEWKTVVGTAMFF
IGFTALVIMWEKLYVYGPLPQTFDKEWVAMQTKRMLDMKVNPIQGLASKWDYEKNEWKK*
72 >lcl|XP_001113793.1|Plus1680544..680810 NW_001095147 ATP synthase subunit f, mitochondrial-like isoform 2 LOC716458 __SEG__ Chr10 {Macaca mulatta} MASVVPVKDKKLLEVKLGELPSWILMQDFSPSGILRAFRRGYYRYYNKYINMSKGSISGITMVLACYVLFNYCISYKHLKHKQLRKYH*
73 >lcl|XP_001114412.1|Plus1complement(17165384..17166937) NW_001101661 aldehyde dehydrogenase X, mitochondrial-like isoform 3 ALDH1B1 __SEG__ Chr15 {Macaca mulatta} MLRFLAPRLLCLQGRTARYSSAAALPSPILNPGISYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGQLLNRLAD
LVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALY
VASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEES
IYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVIERANNT
RYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVLQKNS*
74 >lcl|XP_001114587.1|Plus1complement(1628992..1629501) NW_001100376 succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial OXCT1 __SEG__ Chr14 {Macaca mulatta} MAALKLLSSGLRLCASARGSRGAWYKRCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIGALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKR
MISSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGG*
75 >lcl|XP_001114879.1|Plus15285820..5286824 NW_001102959 l-lactate dehydrogenase B chain LDHB __SEG__ Chr16 {Macaca mulatta} MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNL
VQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEIG
TDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
LKDL*
76 >lcl|XP_001115046.1|Plus115683486..15684376 NW_001098167 UDP-glucuronosyltransferase 1-3-like LOC714484 __SEG__ Chr12 {Macaca mulatta} MATGLQVPLPQLATGLLLLLSVQPWAESGKVLVVPTDGSHWLSMREAVRELHARGHQAVVLTPEVKMHIKEENFFTLTTYAIPWTQDEFDRLVLGHTQWFFETEHLLKRY
SRSMAIMNNMSLVFHRSCVELLHNEALIRHLNATSFDVVLTDPVNLCGAVLAKYLSIPTVFFLRNIPCDLDFKGTQCPNPYSYIPKLLTTNSDHMTFLQRVKNMLYPLAL
SYICHAVSAPYASLASELFEREVSVVDLLSHASVWLFRSDFVMDYPRPIMPNMIFIGGINCANRKPLSRVCIGAFI*
77 >lcl|XP_001115428.1|Plus16487728..6487973 NW_001112552 v-type proton ATPase subunit e 1-like ATP6V0E1 __SEG__ Chr2 {Macaca mulatta} MAYHGLMVPLTVMSMFWGFVGFLVPWLIPTGPYWGVIITTLVTCPVFCCLFWLISVLSQLNPLCGPQLKNEAIWCLKHRWP*
78 >lcl|XP_001116261.1|Plus12197..2385 NW_001096138 cytochrome b-c1 complex subunit 9-like LOC720636 __SEG__ Chr10 {Macaca mulatta} MAAAAFTSKLYSLLFRRTSTFALTIVVGVVFFERAFDQGADAIYDHITEGVRACGILDLGPT*
79 >lcl|XP_001116350.2|Plus1complement(162809..163609) NW_001095210 protein SCO2 homolog, mitochondrial-like isoform 1 LOC720679 __SEG__ Chr10 {Macaca mulatta} MLLLTRSPTAWHRLSHLKPPVLPGTVGGQALHLRSWFLSRQGPAETGRQGQPQGPGLRTRLLITALFGAGLGGAWLALRAEKERLQQQKRIEALRQAAVGQGDFHLLDHK
GQGRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTEQIAQATHSYRVYYSAGPKDEDQDY
IVDHSITIYLLNPDGLFTDYYGRSKSAEQISDSVRRHMATFRSVLS*
80 >lcl|XP_001117178.1|Plus1complement(7047466..7048578) NW_001096629 l-lactate dehydrogenase B chain LDHB __SEG__ Chr11 {Macaca mulatta} MSIACRAGAGGDARSSHRVLRTAVTEVSSAFSLLCKMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQ
TPKIVADKDYSVTANSKIVVVTAGVRQQEGDSRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRMIGSGCNLDSARFRYLMAEKLGIHPS
SCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPC
ILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL*
81 >lcl|XP_002798770.1|Plus1complement(4786359..4786550) NW_001096636 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100423814 __SEG__ Chr11 {Macaca mulatta} MLGHSIRRFTTSVVCRSHYEEGPRKNLPFSVENKWALLVKMCLYFGSAFAAPFLIVRHQLLEQ*
82 >lcl|XP_002798901.1|Plus149198..49392 NW_001097006 cytochrome c oxidase subunit 2-like LOC100426751 __SEG__ Chr11 {Macaca mulatta} MAHPVQLGLQDATSPSIEELITFHDHTFIIVSLISFLVLYVLSSTLTTKLTNTNITDDQDIETI*
83 >lcl|XP_002799009.1|Plus1complement(20511111..20511305) NW_001098160 cytochrome c oxidase subunit 2-like LOC100427690 __SEG__ Chr12 {Macaca mulatta} MAHPVQLSLQDATSPIIEELITFHDHAFIAISLISFLVLYALLSTLTTKLTNTNITDAQEIETI*
84 >lcl|XP_002799290.1|Plus1complement(5590872..5591066) NW_001099000 cytochrome c oxidase subunit 2-like LOC100426351 __SEG__ Chr13 {Macaca mulatta} MAHPVQLGLQDATSPIIEELIAFHDHTFIIVSLISFLVLYVLSSTLTTKLTNTSITDAQEIETI*
85 >lcl|XP_002799366.1|Plus17265670..7265933 NW_001099003 ATP synthase subunit a-like LOC100423785 __SEG__ Chr13 {Macaca mulatta} MLVAIETISLLIQPVALAVRLTANITAGHLLIHLIGNAVLALSTTNLSITLLTSTLLVLLTTLEIAVALIQAYVFALLISLYLQNNT*
86 >lcl|XP_002799772.1|Plus16128783..6128977 NW_001100388 cytochrome c oxidase subunit 2-like LOC100424849 __SEG__ Chr14 {Macaca mulatta} MILPVLLGLQDATSLIIEELLTFHDHALIIIFLISSLVLYIISLILTTKLTHSNTIDAQEIETV*
87 >lcl|XP_002799909.1|Plus1687767..687958 NW_001100395 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100428756 __SEG__ Chr14 {Macaca mulatta} MWGQSIRWLTTSVVCRSYYAEGPGKNLPFSMKNTCRLLTMMTLYLGSGSVATFFRVKHQLLKI*
88 >lcl|XP_002801589.1|Plus1<134804..135013 NW_001108649 v-type proton ATPase subunit G 1-like LOC707071 __SEG__ Chr1 {Macaca mulatta} KKKKEFKAKEAAALGSHGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIQPEIHENYRING*
89 >lcl|XP_002801637.1|Plus115271435..15271626 NW_001108704 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100423198 __SEG__ Chr1 {Macaca mulatta} MLGHSIRRFTTSVVRRSHCEEGPGKNLPFSVKNKWALLVKMCLYFGSAFAAPFLIVRHQLLKS*
90 >lcl|XP_002803215.1|Plus1complement(3475264..3475458) NW_001114168 cytochrome c oxidase subunit 2-like LOC100426412 __SEG__ Chr3 {Macaca mulatta} MARPVQLSLQDATSPIIEELITFHDYAFIAISLISFLVLYALLSTLTTKLTNTNITDAQEIETI*
91 >lcl|XP_002803470.1|Plus15982919..5983269 NW_001114281 l-lactate dehydrogenase B chain-like LOC100426579 __SEG__ Chr3 {Macaca mulatta} MGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQ
KDLKDL*
92 >lcl|XP_002804023.1|Plus1complement(1003..1140) NW_001116790 cytochrome c oxidase subunit 2-like LOC100428562 __SEG__ Chr4 {Macaca mulatta} ELTFHDHALTIIFLISSLVLYIIFLTLTTKLTHTSIKDTQEIETV*
93 >lcl|XP_002804409.1|Plus15853136..5853327 NW_001120965 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100429280 __SEG__ Chr6 {Macaca mulatta} MLGHSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWALLVKMCLYFGSAFAAPFLIVRHQLLKS*
94 >lcl|XP_002804747.1|Plus11290185..1290376 NW_001121147 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100423151 __SEG__ Chr7 {Macaca mulatta} MLGQSVRRFTTSVVCRSHSEEGPGKNLPFSVENKWTLLAKMCLYFGSVFATPFLLVRHQLLKT*
95 >lcl|XP_002804883.1|Plus1complement(3070880..3071071) NW_001121157 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100428967 __SEG__ Chr7 {Macaca mulatta} MLGQSIWRFTTSVVRRSHYEEGPGKNSPFSVENKWALLVKMCSYFASAFASPFLIVRHQLLKS*
96 >lcl|XP_002805311.1|Plus1complement(3443346..3443537) NW_001122887 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100429567 __SEG__ Chr8 {Macaca mulatta} MLGHNIRRFTTSVVGRSHYEEGPGKNLPFSVENKWALLVKMCLYFRFAFAAPFLIVRHQLLKS*
97 >lcl|XP_002805505.1|Plus1complement(3216124..3216318) NW_001122912 cytochrome c oxidase subunit 2-like LOC100424952 __SEG__ Chr8 {Macaca mulatta} MAHPVQLGLQDTTSPVIEELITFHDHAFIAISLISFLVLYALSSTLTTKLTNTNITDAQEIETI*
98 >lcl|XP_002806186.1|Plus12499129..2499320 NW_001218097 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100423866 __SEG__ ChrX {Macaca mulatta} MLGLSIWRFTTSLVHRSHYEEGPGKNLPFSVENKRWLLAKMCLYFGSAFATPFLIARHQLLKT*
99 >lcl|XP_002806312.1|Plus1complement(5133..5327) NW_001218128 cytochrome c oxidase subunit 2-like LOC100423542 __SEG__ ChrX {Macaca mulatta} MAHPVQLGLQDATSPIIEELMTFHDHTLIIVSLISFLVLYVLSLTLTTKLTNTNITYAQEIETI*