SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom C    

ID / Description / Sequence
1 >lcl|XP_001362409.1|Plus1complement(23094..24149) NW_001581903 v-type proton ATPase subunit d 1-like LOC100009856 __SEG__ Chr3 {Monodelphis domestica} MFSFSELHFNANNGYLEGLVRGLKTGLLTHFDYTNLVQCESLEDLKLHLQTTAYGNFLANEVSPLSVSMIDDRMREKLVSEFFYLRNQAFEPLSKFLDFITYSYMIDNVI
LLLTGTLHERSISELMPKCHPLGHFDQIEAVNIAQTQEELYNAILVDSPLAIFFQTHFSKEELQQLNIEILRNTMYKSYLESFYQFCTLLGGITAEVMNPILEFEADRRA
FIITINSFGTELSKQARANLFPNCGLLYPQGQALLAQANEFKEVKAVADFYPQYKELFEAVSSNGGGKTLEDRFFEHEVNLNKLAFLRQFHFGIFYAFVKLKEQECRNVV
WIAECIAQNHRNKIRNYIDIF*
2 >lcl|XP_001362706.1|Plus11430610..1430966 NW_001581928 v-type proton ATPase subunit G 3-like LOC100010693 __SEG__ Chr4 {Monodelphis domestica} MASQSQRIQQLLQAEKRVKDKLEEAKKRKNKWLSQVKEEVMTEVDQHRMQKEKEFQEKQSLVLGSQSNFLGKIDAQTTGKIQKLTSNYNESLESVMKKLLSMVRNLKPEM
HKNYKGTD*
3 >lcl|XP_001363426.1|Plus1complement(3399247..3400302) NW_001581902 electron transfer flavoprotein subunit alpha, mitochondrial-like LOC100010376 __SEG__ Chr3 {Monodelphis domestica} MRRSRGSQDWLVAAAMFLAVLTSVRLRGAVALLLRFRSTLVIVEHENDAPASITLNTVTAATQLGGGVSCLVAGTKCDVVARDLCKVKGVTKVLVAQHDMFKGLLPEELT
PLILATHRQYNYTHICAGASSFGENLLPRVAGKLDVSQISDIIQIKSPDTFVRTLYAGKIICTVKCEEKVKVFSVQGTAFETAATSGGNASVENAPTISPVGLSEWLHQT
LLKNDWPHLTSAKSVVCGGLGLKTRENFKLLYDLAEQLRASVSATLAAVNAGFVPKDLLVGERGKNKTPKLYVAVGISGFMQHLAEIKDSKTIVAINEDPEAPIFQVADL
GIVADLFKVVPELTELLKKKR*
4 >lcl|XP_001366155.1|Plus1complement(41313025..41313921) NW_001581960 ADP/ATP translocase 3-like LOC100018337 __SEG__ Chr4 {Monodelphis domestica} MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIMDCIVRIPKEQGMLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFW
RYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTV
TAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTIDCWRKIAKDEGGKAFFKGAWSNILRGMGGAFVLVLYDELKKVI*
5 >lcl|XP_001367326.1|Plus13373419..3374702 NW_001587052 v-type proton ATPase subunit C 2-like LOC100012947 __SEG__ ChrX {Monodelphis domestica} MSEFWLISIPGDEENLRILERMKNLTSKANLCRNSNFAIPDFKVGTLDSLISLSDELGKLDHLAESLVKRMVQCVIEQKKFKNGEFQEYLLVTGVSLASFVTHFEWDMAR
YSAQQPLWTIVDKLGKQLTQMETDLKTRISVYNKQKRHLENMEEKLTGNLFSRSLSDIVSKEDFVLDSEYLITLLVIVPKASYSKWQKTYESLSDMVVPRSTKLIAEDKE
DGLFTVTMFRQVINEFKAKAAANKFTVRDFFYDEKEIQRERELLNKLLSAKKQQYDSSRRVRKKRTSSFLDHIVKVARFINPWKHQPKQIERKEIKIKNGKRESPYLRWL
KVNFGEVFIIWIHVKALRVFVESVLKYGLPVNFNVILLQPQKKSSKRLREILNLAFKHLDETAASIVDSSLDVPGLQFNNQDYFPYVYFNIGLRFLD*
6 >lcl|XP_001367785.1|Plus182011554..82012012 NW_001581968 v-type proton ATPase 16 kDa proteolipid subunit-like LOC100020212 __SEG__ Chr5 {Monodelphis domestica} MADLNNFAPFFAVMGSAAAMAFTSLGAAYGTAKSSTGIAAMSIMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANTLSPTITLFKSFLQMGAGFSVGLSGMAAGFAIGIV
GDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK*
7 >lcl|XP_001368234.1|Plus167847614..67848750 NW_001581970 v-type proton ATPase subunit C 1-like LOC100022215 __SEG__ Chr5 {Monodelphis domestica} MTEFWLISAPGEKSCQETWERLQAATLPANLSTNVKFNIPQLKIGILDVLVELSDHLKVLDEFVTKLNRNIVKYVSSLLIGNAKDKIGEILLAKENDIITYLTNFQWDMA
KFPITASMRVICEMIEKEVHQIDNDFNSRTAAYEKLRENVKSLEKKQEGTFLTKSLADIVKKEDFVLDSEYLITILVVVPKEIHDKWLKCYETLTDFVVPRSSSIISQDT
EAYLCNVTLFKNKVNDFTALAREKQFMIREFFYDEEVMKKESEALSNALGEKKKNFGPLFRWLQLNFSEAFISWIHVKALRIYVESVLRYGLPVNFQAMLLKPNVRAKKK
LREVLNDLYKHLVDNEFVTDNSLSAPEFVMDKEDYYPYVYLNIDCSLL*
8 >lcl|XP_001369690.1|Plus189384..90424 NW_001581864 phosphate carrier protein, mitochondrial-like LOC100015673 __SEG__ Chr2 {Monodelphis domestica} MSPSSTPRGPWTAVSSSPFLTWQRSRRPRGDRDSPEYGSAKYLALCGLSGGMSTGLSHTMVLPLDLIKCRLQVAPTKYPGLVSGFSLVSLQEGMRGMTRGWAPTLLGFSM
QGFVKFSLYEMFKHRLSRRLSEEGFYVWRTAVYMLAATGAGFFASLVLLPMDIVKMRMQTQPNFPGMLRQAMPKVWSQEGPMAFYRGLGPLWMRQMPYTVVKFACYERTL
EMLYKYAVAKPQCQCSLPQQLAVTFVAGYVSGILGAIVSHPADTAMTILSKENYKKNMFDILQQLGPTSVWNGLSTRILMIGTLSAFQWFFYNVFKVMYRLPRPPPPQMP
ESLRWRLEQQRLRSRR*
9 >lcl|XP_001370113.1|Plus1127056109..127056789 NW_001581879 v-type proton ATPase subunit E 1-like isoform 1 LOC100025792 __SEG__ Chr2 {Monodelphis domestica} MALSNADVQKQIKHMIAFIEQEANEKAEEIDAKAEEEFNIEKGCLVQTQRLKIMEYYEKKEKHIEQQKKIQMSNLMNQARLRVLKARDDLISDLIKEAKERLASIVKDTP
KYQVLLDGLVLQDLYQLLESQMIVHCKKDDLPLVTAAVQKAIPLYKLAAKRDLNVQVDQKTFLPTEISGGIEIYNGNGKIKVSNTLESRLDLIAQQMMPEVRVALFGTNN
NRKFLD*
10 >lcl|XP_001371454.1|Plus118791024..18791494 NW_001582018 v-type proton ATPase 16 kDa proteolipid subunit-like LOC100018100 __SEG__ Chr8 {Monodelphis domestica} MEEGVSQKWFEPFLAIVGCTCAIVFSSLGAAYGIGKSSGGITASAVMRPEQIMRSIIPIVMAGIIAIYGLVVAVVIAHSMEEDISLHTSILQLGSGITVGLCGVAAGYTI
GITGDAGVRGTAQQPRLFAGLVLILIFSEVLGLYGLIVGLILSTSL*
11 >lcl|XP_001371856.1|Plus1complement(19000098..19001033) NW_001581995 mitochondrial carnitine/acylcarnitine carrier protein-like LOC100018766 __SEG__ Chr7 {Monodelphis domestica} MGQGTETLIAEMETGMPISPIKDFLAGGFGGLCLVLVGHPLDTVKVKLQTQPKTLSGQLPRYSGSLDCFRQILVSEGIPGLYRGMAAPLVSVAPILATCFFGFGLGKKLQ
QKNPDEVLTYPQLFAAGMLSGVFTAVIMAPGERIKCLLQIQAASKERKYNGTWDCVRKVYQEAGIRGIYKGTVLTLLRDVPANGMYFMTYEWLKDILTPEGKSVHDLGAL
RILTAGGAAGIFFWVMAIPPDVLKSRFQTAPAGKYPNGFRDVLKELIAQEGVTSLYKGLTAVMIRAFPANAACFLGFEVALSFLNWATPNL*
12 >lcl|XP_001371919.1|Plus1complement(26832908..26833489) NW_001581969 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial-like LOC100018862 __SEG__ Chr5 {Monodelphis domestica} MTILFIYFPPKERLLGGIRWLGAAAQQVIPLGARAASGLSKDMPPGPYPRTPEERTDAAKKYNMRVEDYEPYPDDGFRFGDSPKLPERSQHERDPWYDWDHSELRLNWGE
PMHFDLDMYTRNHVDTSPTPVSWNTMCKHLLSFVGFMLFMFYLGEMYPSYQPVAPKQYPYNNLYLEHGGDPSANPESVKHYEI*
13 >lcl|XP_001372616.1|Plus1complement(12076459..12077364) NW_001581978 mitochondrial carnitine/acylcarnitine carrier protein-like LOC100019931 __SEG__ Chr6 {Monodelphis domestica} MVSQERKTEGTLNSLKNFLAGGFGGMCVVFVGHPLDTVKVRLQTQPKSRLGQPTLYSGTFDCFRKTFLREGIGGLYRGMSAPLIGVTPIFAVCFFGFGLGKQLQQKNPDD
VLTYPQLFVAGMLSGVFTTAIMTPIERIKCLLQIQASQGKTKYTGSWDCLKAVYREAGIRGIFKGTVLTLMRDVPASGVYFMTYEWLKNVFTVERKIGAAGIVVAGGMAG
IFNWMVAIPPDVLKSRFQTAPPGKYPNGFRDVLKEVVQEGGVSSLYKGFTAVMIRAFPANAACFLGFEVALAVLNWITSKF*
14 >lcl|XP_001374742.1|Plus1complement(35315653..35317038) NW_001582021 v-type proton ATPase subunit S1-like LOC100023092 __SEG__ Chr8 {Monodelphis domestica} MAVVARAAAPQRMASAKTAMSLPSLPPLLLLLALVTASAAASDVKRPVPMLIWSSSPAVWVPPANAHEGHVTTDLQLSSYLQLALDKGPPIVLLLLQEELSVEDFTVFGG
AFGNKQDSAFPNLENALKSAPSSLILPLVEWRAINITLPSFLKKWGPRPVIVERASLEELKLKDNASVSLHLTLPHANNSGLVARKMLLTGNDEIIGQVVSKFKAEGAPY
TAIMTAIQPSRVVRDLLLQHRTLNPKPVRKSIHPLCYNDTQPRILFWADHILVNNEYQSLDLNNATFNNPINLTGSSWNSTFAQLVLTYDNIFGPFLTIKFKLSNRFYPI
SARTWFNIDQVELHTTNSAVVFQGTGLTGPSPFSFHCHAFSTAEPDGFLTPPPGPHLWNITFKGFRIQAFHVKANEFAYACDCAGFFSGFIWMGLFSCFFLLLAFIYGLH
MLLDLKTMDTFENPKGRRYYD*
15 >lcl|XP_001374981.1|Plus1complement(5679208..5679897) NW_001587050 phosphate carrier protein, mitochondrial-like LOC100023430 __SEG__ ChrX {Monodelphis domestica} MQVLCMLGLYEAFKGRYSVLMGEEAAYLWRTSLYMMASTSAQFFADALSLPLEAVKIRLKKDPGYAGSLREAIPRMFAEEGLGAFYKGVLPLWAHQMPYTMMKFVAFERA
IEALYLRAMPKPQNRCSSAEQLTVTFSAGYVAGVFCAIVYQPADKILTALNEEKGTRTLAVLQRLGFWGLWRGSASRILMVGAVTALQWFTYDAVKMYFRIPPSPVPSMP
ESLRIKLNQ*
16 >lcl|XP_001375078.1|Plus1167420316..167421212 NW_001581841 ADP/ATP translocase 3-like LOC100031958 __SEG__ Chr1 {Monodelphis domestica} MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIMDCIVRIPKEQGMLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFW
RYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTV
TAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTIDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI*
17 >lcl|XP_001376361.1|Plus1541149..542036 NW_001581886 UDP-glucuronosyltransferase 1-7-like LOC100025419 __SEG__ Chr2 {Monodelphis domestica} MAPVLLGLLPLWSYLLLFGGLAEAGKLLVVPMDGSHWLSMREVVKELHRRGHEVVMVIPEVSWRLGESTPYTVKTYKPEYTLEEYNQVFQRFADSQWDDNFKTLVPMLTN
SNTSLFFKAIFSNGKSLFKNSELLDYIKKSAFDAILFDPFDHCGFFLAKYFSLPSLVFSRGIFCHYLEEATQCPSPLSYVPRGMSGLSDSMTFVDRVWNHFFHFQEVSLC
SFLFKTILDTASDIFQRPMTIKELYSHTSIWLLRTDFVFEYPKPLMPSIVFVGGITCHEVKPLSKVSLLLCEQDT*
18 >lcl|XP_001376379.2|Plus1555498..556433 NW_001581886 UDP-glucuronosyltransferase 1-10-like LOC100025445 __SEG__ Chr2 {Monodelphis domestica} MAPVLQPGGLLPLWSCLLLFGGLAEAGKLLVVPMDGSHWLSMREVVKELHRRGHEVVMVIPEVSWRLGESAPYTVKTYKSEHTLEEYNQVFQRFADGQWDGSFKTLVPLL
SNSNTTELFKAIYSNCRSLYKNSELLDYIKESAFDAVFFDPFDHCGFILAKYFSLPSVAFTRMVFCHHLDEATQCPSPLSYVPRGISGLPDSMTFMERVWNLFFHLQEVS
LCSHLLKYSLDIASDILQKPMTFKELYSYTSFWLLRTDFVFDYPKPLMPNMVLVGGITCHEGKPLSKVSLLLCGQDAWLGRSRSQEEFLDA*
19 >lcl|XP_001376420.2|Plus1632148..633038 NW_001581886 UDP-glucuronosyltransferase 1-10-like LOC100025503 __SEG__ Chr2 {Monodelphis domestica} MAPVLQPGGLLPLWSCLLLFGGLAEAGKLLVVPMDGSHWLSMREVVKELHRRGHEVVMVIPEVSWRLGESAPYTVKTYKPEYTLEEYNEMFQRFADHQWNNMRQTFSSLM
SNVNILEFFEKVCSNCRSLYKNSELLDYIKESAFDAVFFDPFDHCGFILAKYFSLPSVVFTRGLFCHYQDEATECPSPLSYVPRELSGCTSSMTFMQRVWNHFFHLQEVS
LCSFFLTRLLSFTSDIFQRSMTLKELYSQPSIWLLRTDFVFDFPKPLMPNMVFVGGITCYEEKALSKVSHLCGQDI*
20 >lcl|XP_001376446.1|Plus1650556..651470 NW_001581886 UDP-glucuronosyltransferase 1-6-like LOC100025544 __SEG__ Chr2 {Monodelphis domestica} MKAYSCLPLYWGVGSLFFLAFWDTAGSEKLLVLPIDGSHWLSMRDVTEELSKKGHEIVVLAPDVNLLLKESKFYKRKLFPVSYSQAELEKRFQTFGHRLFDERSFLGTAW
AEYCNNRHIIDLFFFNCDSLLKEQETIRYLEESKFDALLTDPALPCGVILAEHLAIPSVYFFRGFPCALEHAMSRTPNPVSYIPRCYTAFSHQMTFFQRVINFLVADLES
LLFKDLYTKYLKIASDFLKREVALPALYAKGSIWLLRYDFVFEYPRPIMPNMAFVGGINCKQRKKLRQVCDVGFLRCFPPRTPA*
21 >lcl|XP_001376466.1|Plus1663787..664656 NW_001581886 UDP-glucuronosyltransferase 1-3-like LOC100025583 __SEG__ Chr2 {Monodelphis domestica} MGLPCLPWALLRLAFCAACLGCAQGGKLLVIPVDGSHWLSMREVVQELSRRGHESIVLAPELTVHIREGPSYTLRTYPVTFSKDRFHELIHNSSQKIFQSEPLLKRIFDG
IATLKTLYEINLNFCTELVYNEELMKSLEEAKYDAVLTDPVIPCGAIVAQYLSIPAVYFLRGLPCGFDTESTQCPNPPSYVPRLATGNSDRMTFLERVKNVLYPSPQNAV
CLMLFSPFARLASELLQRDLSIVDVLSHGSVWLLRTDFLLEYPKPVMPNMVFIGGINCASNKQLPQVGG*
22 >lcl|XP_001376478.1|Plus1667527..668528 NW_001581886 UDP-glucuronosyltransferase 1-3-like LOC100025604 __SEG__ Chr2 {Monodelphis domestica} MARGLPHLPWLLVGLVAWAACLGCAQGGKLLVIPVDGSHWFSVREVVQELSRRGHESVVLAAELSMHIREGPLYTLRTFPVNFSNDQFEEVQGDPETLFEASNFLQRFFD
MAKIMKRYADMQSSFCTDLVSNKELMSALEQAHYDAVLTDPVNPCGAILALHLSLPAVYYFREIPCDFLAAGTHCPVPSSYVPRMFTENADRMTFPERVKNMLYALPHSV
ACHIMYSSFTKLATELLDRDVSIADILSHGSVWLLRSDFALDYPRPLMPNMVFIGGMSCASTKQLPQVGMWRVRGRRPASCEPSSNERRRLSLGSSMLFSGDNESAFSWV
SCQ*
23 >lcl|XP_001377645.1|Plus1complement(3767273..3768700) NW_001581936 v-type proton ATPase subunit S1-like LOC100027317 __SEG__ Chr4 {Monodelphis domestica} MTRAAVLRQPRGSLRRRRSKSLPGLLLLQLLLLAPRADASDPQVPLLLWSSIPDLQPSLENPYEGHIYTRPELYSCLDPILEKGPQAVLLILQEKLRLEDFTAFGEVPGD
KPESPFPNLQEVLKGAPSSLVLPAVGWSAAATLTSYLTQKLGTGPLHVDQASLRELRLNTTHPLLLLVYIPSTASTDLDAHKEALADQDKILGQVLSRLQAEGKPYTALL
TALRPSRIARDVSLVSGGLGQQLLGDSQEYKTQPAWPSVLPPVSYGDTEPRILFWARQFTVSYGRQTQDLTSLTFGAPELNLTGSSWNDSAAQLVMTYNNLFGPFLRLKF
SMINHFYPGSHRSWFIMEGLEIKTHNSTAFFSSVQVIAPSTHSYHCHYVSSDLTKWGILMPHDFLSPWSVTLQDFQIQAFNLSGGSFSGASDCAAFFSPAIWMGLVSSLF
MLFCITFGVHIIFKLKSLNRFDEYKGDPLFEPLMD*
24 >lcl|XP_001377817.1|Plus184469313..84470329 NW_001581961 mitochondrial folate transporter/carrier-like LOC100027551 __SEG__ Chr4 {Monodelphis domestica} MAAVPPPGQNVASRPPCSTQPIQKDQERVPEVLAVATPLAIFYHVRYENLVGGVIGGILSNLVLHPMDLVKIRFAVSDGLRVRPKYRGIAHCLHTIWKQDGVRGLYQGLT
PNVWGAGLSWGLYFCFYNAIKSYKSEGRTDQLKAPDYLFSAAQAGAMTLCFTNPLWVTKTRLMLQYDHSPEKRKYDGMIDTLVKIYKADGVRGLYRGFMPGLLGTSHGAL
QFMTYEMLKKRYNEHMARMQEAQLSTIEYISIAAIAKIFAVAATYPYQVVRARLQDQHIYYQGIRHVIRRTWKKEGIQGFYKGIVPNLITVTPACCITFVVYENVSQFLC
DLREGPLK*
25 >lcl|XP_001379418.2|Plus1complement(14385436..14387145) NW_001581878 NADP-dependent malic enzyme-like LOC100029738 __SEG__ Chr2 {Monodelphis domestica} MEGSAPNHYTQKRGCDVMRCPHLNKDMAFTLEERQQLNIHGLLPPCFLDQDIQVLRVVKNFERLNSDFDRYLLLMDLQDQNEKLFYRVLTSDIEKFMPIVYTPTVGLVCQ
LYGLVFQRPRGLFISIHDRGHIATLLKSWPEDIVKAIVVTDGERILGLGDLGCNGMGIPVGKVVLYTACGGMNPEECLPVTLDVGTENEELLKDPLYIGLRQKRVRGSDY
DDFLEEFMEAVTCRYGMNCLIQFEDFANTNAFRLLEKYQNKYCTFNDDIQGTASIVVAGLLAALHITQNKLSDHTVLFQGAGEAALGIAKLLIMAMKKEGTCQEEAIKKI
WMVDSKGLIVKGRAFLTYEKERFAHDHYEMKNLEKIVQEIKPTILIGVSAVGGAFTEQILNDMASFNERPIIFALSNPTSKAECTAEQCYQMTGGCGIFASGSPFNPVTL
PDGRTFYPSQGNNSYVFPGVALGVVACGLRHIPDKIFLTTAEVIAQEVSNEHLEEGRLYPPLKTIQDVSLKIAVKIVEESYHDNSATIYPEPQDKEAFVRSKIYHTNYDH
ILPDCYSWPKETMKIQTVN*
26 >lcl|XP_001379499.1|Plus1complement(35865008..35866141) NW_001581841 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial-like LOC100029846 __SEG__ Chr1 {Monodelphis domestica} MVMTLVALSPRILTISQSGITSVATSLFLAQSHRHLHHAFIPHGKGGRSSFSGIVATVFGATGFLGRYVVSHLGRIGSQVIIPYRCEPYDITYLKPMGDLGQLIFLEWNA
KIRSSIQRALEHSNVVINLIGRDWETNNFDFSDVFATIPQSIARLAKEAGVETFIHVSHLNADLRSTSKYLRNKAVGEIAVKDEFPEAIILKPSDIFGREDRLLNYFANI
RWFGGVPLISLGRNTVKQPVYVVDVSKAIINAIKDPGARGKTYAITGPHRYLLCDLVQYIFAVAHRPYVPYYMPRFAYHLMARIFEMNPFEPWTTRDKVERMHITDRKLP
HLPGLADLGVEATPLELKAIEVLRRHRTYRWLSAEIKDTKPPKTVDF*
27 >lcl|XP_001379983.1|Plus1complement(40731327..40731968) NW_001581875 ATP synthase subunit O, mitochondrial-like LOC100030487 __SEG__ Chr2 {Monodelphis domestica} MAVAATSGAVQQIRRFTTSVARPFAKLVRPPIQLYGLEGRYATALYSAASKQNKLDAVERELNRVTKLLKEPKTVASFMNPHIKRTIKMAALNDLIAKEKFSPITTNFMK
LLAENGRLNNTPGIISAFSTIMSVHRGEVPCSVTTASALDSATLSELEAVLNSFLRKGQVLKMEAKTDPSIMGGMIVRIGEKYVDMSARTKIQKLSRIMREAV*
28 >lcl|XP_003339625.1|Plus15727838..5728836 NW_001581838 l-lactate dehydrogenase A chain-like LOC100012604 __SEG__ Chr1 {Monodelphis domestica} MGTVKDQLILNVLKEEQTPHNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYAVTANSKLVVITAGARQQEGESRLNLV
QRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYLMGEKLGIHSSSCHGWILGEHGDSSVPVWSGVNVAGVSLKSLHPALGT
DSDSEQWKDVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTTEEESRLKQSADTLWGIQKEL
QF*
29 >lcl|XP_003339708.1|Plus1complement(120918526..120919422) NW_001581841 ADP/ATP translocase 3-like LOC100030680 __SEG__ Chr1 {Monodelphis domestica} MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIMDCIVRIPKEQGMLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFW
RYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTV
TAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTIDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI*
30 >lcl|XP_003339816.1|Plus1complement(27381675..27382673) NW_001581842 l-lactate dehydrogenase A chain-like LOC100016009 __SEG__ Chr1 {Monodelphis domestica} MGTVKDQLILNVLKEEQTLHNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYAVTANSKLFVITAGARQQEGESRLNLV
QRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKLSGFPKNRVIESGCDLDSARFHYLMGEKLGIHSSSCHGWILGEHGDSSVPVWSGVNVAGVSLKSLHPALGT
DSDSEQWKDVHKQVVESIYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDMVKVTLTTEEESHLKQSADTLWGIQKEL
QF*
31 >lcl|XP_003339824.1|Plus1complement(4216717..4217613) NW_001581842 ADP/ATP translocase 3-like LOC100010487 __SEG__ Chr1 {Monodelphis domestica} MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIMDCIVRIPKEQGMLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFW
RYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTV
TAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTIDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI*
32 >lcl|XP_003340009.1|Plus1complement(61390355..61391353) NW_001581859 l-lactate dehydrogenase A chain-like LOC100023295 __SEG__ Chr1 {Monodelphis domestica} MGTVKDQLILNVLKEEQTPHNKRTVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYAETANSKLVVITAGAHQQEGESRLNLV
QRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKLSGFPKNLVIGSGCNLDSARFCYLMGEKLGIHSSSCHGWILGEHGGSSVPVWSSVNVAGVSLKSLHPALGT
DSDSEQWKDVHKQVVESAYEVIKLEGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTTEEESRLKQSANTLWGIQKEL
QF*
33 >lcl|XP_003341640.1|Plus118350833..18352386 NW_001581976 aldehyde dehydrogenase X, mitochondrial-like LOC100019618 __SEG__ Chr6 {Monodelphis domestica} MLRLLAPRLSRLCTGVAPYSSAASLPNPVLQPEVRYDKLFINNEWRDAVSKKTFPTVNPSTGEVITHVAEGDKADVDLAVKAAREAFRLGSPWRQLDASERGRLLYRLAD
LVERDRIYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKFHGKTIPMDGELFCYTRHEPIGVCGQIIPWNFPLVMQGWKLAPALAAGNTVVMKVAEQTPLSALY
LASLIKEAGFPPGVVNIITGYGPTAGAAVAQHMDIDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMNHAVEQCHEALFFNMGQCCCAGSRTFVEDS
IYDEFLERTVEKAKKRKVGNPFELDTQQGPQIDKEQFEKILGYIQVGQKEGAKLMCGGERFGEKGFFIKPTVFGNVQDNMRIAKEEIFGPVQPVFKFKKISEIIERANDT
KYGLAAAVFTKDLDKAMYLTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLREYVEVKTVTIKIPQKNS*
34 >lcl|XP_003342082.1|Plus1complement(26771559..26771840) NW_001582020 cytochrome b-c1 complex subunit 8-like LOC100619775 __SEG__ Chr8 {Monodelphis domestica} MGHEFGNLIWIKHIISYSLSPFQQRAFPNYFLKGISNMTRWMQDSILCVTSPLLPFIGFYLLYNWGTQEFENSKKKSPDAFEKDKSTTQRELQ*