SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab C    

ID / Description / Sequence
1 >lcl|XP_001490396.1|Plus1complement(6266874..6267674) NW_001867400 protein SCO2 homolog, mitochondrial-like LOC100056712 __SEG__ Chr28 {Equus caballus} MLLLALAPRAWLRLPQLKRLVCPRTLGGDSLRMRCQLLSRQGPAETGKQGQPQGPGLRTRLLITALFGAGLGGAWLAARAKKEQWRQQRRTEALRQAAVGQGDFSLLDHR
GQARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVQQLEAEPGLPLVQPIFITVDPERDSVEAMARYVQDFHPRLLGLTGSAEQIAQASHNYRVYYSAGPKDEDQDY
IVDHSIAIYLLNPDGLFTDYYGRARSAEQIADSVRHHMATFRSVLP*
2 >lcl|XP_001495118.1|Plus1complement(21419379..21419705) NW_001867389 ATP synthase-coupling factor 6, mitochondrial-like LOC100067186 __SEG__ Chr20 {Equus caballus} MIVQTLFKFFSVVQSATSVHLQRNVGVTAVAFNKELDLLQEFFVDKIREYKSKGWVSGGPVEIGPEYQQALERELFKFKQIYGKAKMTVFPNFIFEDPDFEMMGKPQS*
3 >lcl|XP_001495913.2|Plus113008711..13009730 NW_001867422 UDP-glucuronosyltransferase 1-6-like LOC100065196 __SEG__ Chr6 {Equus caballus} MACLLRAFGRVSAGVFFLSLWGMSVGDKLLVFATDGSHWLSMKDIIEPLSEKGHDIVVLVPEVSLLVKESKYYTRRIYPVPYDEEELKRCVRSFGKNHFAERWLLNAAQA
AYRNIMMLMDVAFLNCQSLLNHSETLSFLRESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLQYAFTRSPNPVSYVPRCFTQFSDQMTFPQRVANFLVSYLEPF
LFCCVLSKYEDPTWNLLKRDVHLPALYQKGSIWLLRYDFVFEYPKPVLPNMVFIGGVNCKKEGILSQVGVLFLFDCPYSLWVDILLPHSVLSVVWLRGLTVTWGGCVKNS
IGKGMPGWE*
4 >lcl|XP_001497358.3|Plus1complement(20383352..20384293) NW_001867366 calcium-binding mitochondrial carrier protein Aralar1-like LOC100067208 __SEG__ Chr11 {Equus caballus} MAVKTTKQGDPQELRNIFLQYASTEVDGEHYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVK
EIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGLISGLDFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSLSYFNAF
NSLLNNMELVRKIYSTLAGTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNATGHLTLAHIERIAPLAEGALPYNLAELQRQVGGVS*
5 >lcl|XP_001498932.1|Plus149043033..49043713 NW_001867379 v-type proton ATPase subunit E 2-like LOC100053341 __SEG__ Chr15 {Equus caballus} MALSDVDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSTIKNQARLKVLRARDDLISELLNEAKLRLSRVVADPE
IYQGLLDQLVLQGLLRLLEPVVIVRCRPQDLLLVEAAVQKAIPDYISVSQKRVEVRVDQEVHLAMMAAGGVEVYSGNQRIKVSNTLESRLDLLAQQKMPEIRKALFGANA
NRKFFI*
6 >lcl|XP_001502541.3|Plus189938031..89938975 NW_001867387 olfactory receptor 11H7-like LOC100072530 __SEG__ Chr1 {Equus caballus} MNNSRISTATQFVLLGFPGPWKMQIILFLMILLVYILTLTGNMAIICAVRWEHRLHTPMYMLLANFSFLEIWYVTYTVPNMLVNFLSKTKTISFSGCFTQFYFFFSLGTT
ECFFLCVMAYDRYLAICRPLHYPSIMTGQLCTILVSLCWLIGFLGYSIPIFFISQLPFCGPNIIDHFLCDMDPLMALSCAPKPIIQYVFYSMSSLIIILTIVYILGSYTL
VLRAVLQVSSSSGRQKAFSTCGSHLVVVSLFYGTIMVMYVSPTSGNSVAMHKIITLIYSVVTPVLNPFIYSLRNRDMKFALHQVFCRMRIIQIS*
7 >lcl|XP_001502549.2|Plus189966283..89967245 NW_001867387 olfactory receptor 11H4-like LOC100072536 __SEG__ Chr1 {Equus caballus} MMFSVFSAALGCMNKSTTRTVTEFVLLGFPGCQEMQSFLFSLFFGIYIFTMMGNGAIVCAVRLDQGLHTPMYLLLGNFAFLEIWYITSTVPSMLVNIFSVTKSISFVGCF
LQLYFFTSLGTTETYFLCIMAYDRYLAICRPLHYTTVMTQRLCYILMSLCWVFGFLSYSVSTVQLSQLPFCGPNTIDHFVCDMDPLIALSCAPAPVTEIIFYVLNSLIII
LTLLYILSSYSLLLIAVLKIPSAAGQQKAFSTCGSHLTVVCLFFGALMAMYVSPTTDNPAEMQKIVTLFYSVVTPFLNPLIYSLRNKEMKAALKKVLKIK*
8 >lcl|XP_001503528.2|Plus1complement(18488134..18489687) NW_001867402 succinyl-CoA:3-ketoacid-coenzyme A transferase 2, mitochondrial-like LOC100054330 __SEG__ Chr2 {Equus caballus} MAGLVVLSAALGRRVSTGRSGRALAEGGVCGFASSARARARFYTDPVEAVRDIADGAKIMVGGFGLCGIPENLIRALLKTRVRDLTVVSSNVGVDDFGLGLLLGTKQITR
IICSYAGENALCEQQYLAGELELELTPQGTLAERIRAGGAGVPAFYTPTAYGTLVQEGGAPIRYFQDGHIAILSQPREVREFHGHHYLLEHAITADFALVKGWKADRAGN
VIFRRSARNFNVPMCKAANTSVVEVEEIVDVGSFAPEDIHVPNIYVDRVIQGEKYEKRIERLTIRKEESGKAKAAEDIRTWIIKRAALEFEDGMYANLGIGIPLLASNYI
SPNITVHLHSENGILGLGPFPRKDQVDADLINAGKQTVTIFPGGCFFSSDDSFAMIRGGHIHLTMLGAMQVSKYGDLANWMIPGKRVKGMGGAMDLVSSAKTRVVVTMEH
STKANEPKILEKCTMPLTGKRCVDRVITERAVFDVDKKRGLTLTELWEGLTVEDIRKSTGSTFAVSPDLRPMQQVAP*
9 >lcl|XP_003365160.1|Plus146987333..46987539 NW_001867420 ATP synthase subunit f, mitochondrial-like LOC100630864 __SEG__ Chr5 {Equus caballus} MASVIPVKEKKHMDVKIGELPSEILKLDFTSKGIAGAFQSRYCQYYNGVNGKEGSISGVSKVLAAYVF*
10 >lcl|XP_003365195.1|Plus113058907..13059908 NW_001867422 UDP-glucuronosyltransferase 1-3-like LOC100630747 __SEG__ Chr6 {Equus caballus} MAVGLRVPLLALAGLLLFLCVGPWAEGGKVLVVPMEGSHWLSMREVVRELHARGHQVVVLSPEVTLHVKKEDFFTMKTYSVSYTQDEFDHLLLGQSHTAFERAHFLKRLW
TSMTNLQKASLIFQKFCEELVYNKDLISHLNASSFDVVLTDPVYPCGAVLAAYLKLPAVFFLRHIPCDLDFESAQCPNPSSYVPKLLTMNSDHMTFLQRVKNMLYPLSLK
YICHVTLVSYASLASKLLQREMSLVDVLGSASVWLFRGDFVLDYPRPIMPNMVFIGGINCAHRKPLSQVSIGALIQSMFQAEHIFFVTYSQVLTYPPIFLEISTSHSPSN
NLP*
11 >lcl|XP_003365508.1|Plus1complement(7143464..7143652) NW_001867428 cytochrome b-c1 complex subunit 9-like isoform 2 LOC100630846 __SEG__ Chr8 {Equus caballus} MAAPTFTARLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINQGVRAWVIPDLGPA*