SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam C    

ID / Description / Sequence
1 >lcl|XP_003431737.1|Plus1176197..176508 NW_876254 ATP synthase subunit g, mitochondrial-like LOC100682716 __SEG__ Chr12 {Canis lupus familiaris} MAQFVRNLAEKAPALLNAAVTYSKPRLATFWHYARVELVPPTPAEIPTAIQSLKKIVKSAQTGSFKQLTVKEALLNGLVATDVWMWFYVGEIIGKHGIIGYNV*
2 >lcl|XP_003431921.1|Plus1complement(7668154..7668579) NW_876258 ATP synthase lipid-binding protein, mitochondrial-like LOC100685007 __SEG__ Chr14 {Canis lupus familiaris} MFACAKLACIPVLIRAGSRVAYRPISASLLYRPEARTGEHSTVFNRAQNGVPQLIQREFPTSAIRRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSFITGYARNPLLKQ
QQFSYAILGFALSEALGLFCLMVAFLILFAM*
3 >lcl|XP_003431989.1|Plus1complement(49450606..49450872) NW_876259 ATP synthase subunit f, mitochondrial-like LOC612408 __SEG__ Chr15 {Canis lupus familiaris} MASPVPVKEKKLMEVKLGELPGWILMRDFTPKGIAGAFQRGYYRYYNKYINVKKGGVAGISMVLAAYVLFNYCRSYKELKHERLRKYH*
4 >lcl|XP_003432346.1|Plus117126845..17127201 NW_876265 V-type proton ATPase subunit G 1-like LOC100685172 __SEG__ Chr18 {Canis lupus familiaris} MASQSQGIQQLLQAEKRAAEKVADARKRKARHLKQAKEKAQMEVELYRREREQEFQSKQQAATGSQGNLSAEVEQATRRQMQGMQSSQQRNRERVLAQLLGMVCDVRPQV
HPNYRIAV*
5 >lcl|XP_003432530.1|Plus1complement(19122822..>19123295) NW_876267 ATP synthase subunit d, mitochondrial-like LOC100688998 __SEG__ Chr19 {Canis lupus familiaris} KLALKTTDWVAFGEIIPRNQMAIANSLKSWNEMLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKFPVPEDKYTVQVDAEEKKDVKSCAEFLSLSKARIEE
YEKELEKMKNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHKPIENL*
6 >lcl|XP_003432808.1|Plus1complement(4171413..4172339) NW_876271 vomeronasal type-1 receptor A16-like LOC100683494 __SEG__ Chr20 {Canis lupus familiaris} MNKNNKPSSFIDVKNASFSEIGIGITANAILLIFHFNTLFLKHRPKPTDLIIVHLALIHIVMLLTMGFMTADIFGSQKLWDDIKCKSVIYFYRLMRGLSFCTTCLLSVTQ
AITLSPRSSYLAKFKHKSSHQNMYSIFFLWVFNTAINSNFLISTIATPNVTSACLLFVTESCSLCPVSYFFRYIYFALVAFQEVSMMGLMALSSGYMVILLYQHKRQTQH
LHSTNLSSKTSPEKKATATILLLMSFFVVMYFLDFIVSSSSRMLWNNDPVRLCVQMIVGNGYATISPLLLISTKRQKSKNDNKCVIFL*
7 >lcl|XP_003433125.1|Plus1complement(3467789..3468175) NW_876274 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6-like LOC100684565 __SEG__ Chr22 {Canis lupus familiaris} MAGYTPDEKLRLQQLQQLRRRWLKDQELSPWEPVLPPQRVWPMEKFWNKFLRDQTPWKNVIYKVYRHSIFAFTHVLIPAWIVHYYIKYHMNAKPYAIVERKPRIFPGDII
LETGEVIPPMKEFPDQHH*
8 >lcl|XP_003433244.1|Plus1complement(17889452..17889769) NW_876277 ATP synthase-coupling factor 6, mitochondrial-like LOC100684246 __SEG__ Chr24 {Canis lupus familiaris} MILQRLFRFSSLIRSAVSVHLRKNIGVTAVAFTKELDPVQKLFVDKIREYRTKRQTSGGPVDTGPEYQQDLEKELFKLKQMYGKADMNTFPDFKFEDPKSWTNPS*
9 >lcl|XP_003433269.1|Plus1complement(17406876..17407181) NW_876277 ATP synthase subunit g, mitochondrial-like LOC100688245 __SEG__ Chr24 {Canis lupus familiaris} MAQFVRNLAALALLNAAVTYSKPRLATFWHYARVELVPPTPAEIPTAIQSLKKIVKSAQTGSFKQLTVKEALLNGLVANEVWMWFYVGEIIGKRGIIGYNV*
10 >lcl|XP_003433342.1|Plus19711958..9712224 NW_876278 ATP synthase subunit f, mitochondrial-like LOC100684880 __SEG__ Chr25 {Canis lupus familiaris} MVSPVPVKEKKLMEVKLGELPGWILMRDFTPKGIAGAFQRGYYWYYNKYINVKKEGVAGISMVLAAYVLFNYYSSYKELKHERLRKYH*
11 >lcl|XP_003433376.1|Plus126468203..26469081 NW_876279 UDP-glucuronosyltransferase 1-8-like LOC100688543 __SEG__ Chr25 {Canis lupus familiaris} MAATILTGFPLLCVCLLLTSGFAEAGKLLVVPMDGSHWFTMRLVVEQLIQRGHELVLIIPEVSWQLGKSSNFTVKTYSTTYNLEELNQMFKNFSDSHWNIRQQSLLTMFF
DSSSDIFEHLFLHCKNLFSDPKLVEYIKESSFDAVFLDPFDVCGLIVAKYFSLPSVGFTRRLYCHYLEEATQCPSSPSYVPRPFSILSDVMSFRERVRNHIFHLEEHLFC
HYFLKTALEVASEILQKAVTPYDLYSHMSIWLLRTDFVFDYPKPVMPNMVFIGGINCQEGKPLPKVSYLFFA*
12 >lcl|XP_003433377.1|Plus126498150..26499028 NW_876279 UDP-glucuronosyltransferase 1-8-like LOC100688694 __SEG__ Chr25 {Canis lupus familiaris} MAATILTGFPLLCVCLLLTSGFAEAGKLLVVPMDGSHWFTMRLVVEQLIQRGHELVLIIPEVSWQLGKSSNFTVKTYSTTYNLEELNQMFKNFSYSQWKTQQQSSLFLVL
SPLKDSLEHLFLHCKNLFSDPKLVEYIKESSFDAVFLDPFDVCGLIVAKYFSLPSVGFTRRLYCHYLEEATQCPSSPSYVPRPFSILSDVMSFRERVRNHIFHLEEHLFC
HYFLKTALEVASEILQKAVTPYDLYSHMSIWLLRTDFVFDYPKPVMPNMVFIGGINCQEGKPLPKVSYLFFA*
13 >lcl|XP_003433378.1|Plus126507842..26508759 NW_876279 UDP-glucuronosyltransferase 1-10-like LOC100688763 __SEG__ Chr25 {Canis lupus familiaris} MAATILTGFPLLCVCLLLTSGFAEAGKLLVVPMDGSHWFTMRLVVEQLIQRGHELVLIIPEVSWQLGKSSNFTVKTYSTTYNLEELNQMFKNFSYSQWKTQQQSSLFLVL
SPLKDSLEHLFLHCKNLFSDPKLVEYIKESSFDAVFLDPFDVCGLIVAKYFSLPSVVFTRGLFCHFFEESTQCPSPLSYVPRPFSMLSDAMSFRERVRNHIFHLEEHLFC
HYFLKTPLEVASEILQTAVTPYDLYSHTSIWLLRADFVLDYPKPVMPNMVFIGGINCQEGKTLPKVSYLFFCVVRIIWLWTLEKK*
14 >lcl|XP_003433706.1|Plus19310123..9310434 NW_876288 ATP synthase subunit g, mitochondrial-like LOC100687786 __SEG__ Chr29 {Canis lupus familiaris} MAQFICNLAKKALALMNAAVTYSKPPLATFWHCARVELIPPASAEIPTAIQRLKKIVKSTQTGSFKQLTVKEALLNGLVSTKVWMCFYFSEIIGKHGIIGYNV*
15 >lcl|XP_003433948.1|Plus1complement(11870436..11870627) NW_876294 cytochrome c oxidase subunit 7C, mitochondrial-like LOC100686264 __SEG__ Chr30 {Canis lupus familiaris} MWGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLLMMTLYFGSGFAAPFFMVRHQLLKK*
16 >lcl|XP_003434234.1|Plus1complement(17256110..17256370) NW_876302 cytochrome c oxidase subunit 6B1-like LOC100688448 __SEG__ Chr35 {Canis lupus familiaris} MAEDIRSKIKNYQTPPFDSHFPNQNQTRNCWQNNLDFHRCEKTMTAKRGDVSVCEWYRCVYKSLCPISWVSAWDDRRTEGTFSGKI*
17 >lcl|XP_003434261.1|Plus1complement(1897703..1898188) NW_876302 ATP synthase subunit d, mitochondrial-like LOC100684996 __SEG__ Chr35 {Canis lupus familiaris} MAGRKLALKTIDWVAFGEIIPQNQKAFANSLESWNEMLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTVQVDAEEKEDVKSCAEFLSLSKT
RIEEYEKELEKMKNIIPFDQMTIEDLNEVFPETKLDKKKYPYWAHKPIEKL*
18 >lcl|XP_003434441.1|Plus135143469..35143774 NW_876307 acylphosphatase-1-like LOC609507 __SEG__ Chr3 {Canis lupus familiaris} MNMAEGDTLISVDYEIFGKVQGVFFHKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPISKVHLMQEWLETKGSPKSHIDRANFRNEKVILKLDYSDFQIVK*
19 >lcl|XP_003434787.1|Plus1complement(755168..755695) NW_876317 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like LOC100688742 __SEG__ Chr6 {Canis lupus familiaris} MAAASMSAALRRMLWGERAAAAAARSVSRAPARSLSTSTWRLAQDQARDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARDNMQSGVNNTKKWKMEFDTRERWENP
LMGWASTADPLSNMVLTFSTKEDAAAFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK*
20 >lcl|XP_003435083.1|Plus1complement(41878661..41878906) NW_876327 V-type proton ATPase subunit e 1-like LOC100683949 __SEG__ Chr8 {Canis lupus familiaris} MAYNGLTVPLIMISVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP*
21 >lcl|XP_003435532.1|Plus147534610..47534825 NW_879562 ATP synthase subunit e, mitochondrial-like LOC100683222 __SEG__ ChrX {Canis lupus familiaris} MVSLMQVCLLIKFKCYSVLFLGVANGAKCYSYLKPQAEEERKIAAEEKEKQDEQKQIERELAKAQDGSIIT*
22 >lcl|XP_003435538.1|Plus1complement(20494096..20494428) NW_879562 cytochrome c oxidase subunit 6A1, mitochondrial-like LOC100685383 __SEG__ ChrX {Canis lupus familiaris} MAVVAAVFQLSGLLGQSRAQLGQSMLSGAHSKEGSARIWKALTHFIVLPGVGLSMLNGFLKSHHGEHGRLEFIAYPHLHIRSKPFSWGDGNHTLFHNSHVNPLPTRYEDE
*
23 >lcl|XP_003435585.1|Plus1complement(59685156..59685371) NW_879563 ATP synthase subunit e, mitochondrial-like LOC100684805 __SEG__ ChrX {Canis lupus familiaris} MVLLVQVSPLIKLNHDPVLFLSVAYGVKRYSYLRPQAKDERRRAAEEKKKQDEQKWIERELSEAQDDSLLK*
24 >lcl|XP_531663.1|Plus1complement(8720250..8720735) NW_876250 ATP synthase subunit d, mitochondrial-like LOC474433 __SEG__ Chr10 {Canis lupus familiaris} MAGQKLALKTIDWVAFGEIIPRNQKAIANSLKSWNEMLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKFPVPEDKYTVQVDAEEKEDVKSCAEFSSLSKA
RIEEYEKELEKMKNIIPFDQMTIEDLNEVFPETKLDKKKYSYWPHKPIENL*
25 >lcl|XP_532330.1|Plus123604666..23605148 NW_876255 ATP synthase subunit d, mitochondrial-like LOC475098 __SEG__ Chr13 {Canis lupus familiaris} MAVRKLALKTIDWVAFGEIIPRNRKAIANSLKSWNEMLTSRLATLPEKPPAIDWAYYKANVAKAGLLDDFEKKFNALKVPVPEDKYTVQVDAEEKEDVKSCAEFLSLSKA
RIEEYEKELEKMKNIIPFDQMTTEDLNEVFPETKLDKKYPYYPHKPIENL*
26 >lcl|XP_532332.1|Plus128340602..28341606 NW_876255 L-lactate dehydrogenase B chain-like isoform 1 LOC475101 __SEG__ Chr13 {Canis lupus familiaris} MATLKEKLIAPVAEEEAAIPNNKITVVGVGQVGVACAISILGKSLADELALVDVLEDKLKGEMMDLQDGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESCLNL
VQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMVEKLGIHPRSCHGWILGEHGDSSVVVWSGVNVAGVSLQELNPEMG
TDNDSENWKEVHKMVVESAYEVIKLKGYTSWAIGLSVADLIASMLKNLSRIHPVSTMVKGMCGIENEVFLSLPCILNTWGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
LKDL*
27 >lcl|XP_532506.1|Plus1complement(44547736..44548218) NW_876258 ATP synthase subunit d, mitochondrial-like LOC475273 __SEG__ Chr14 {Canis lupus familiaris} MARRKLALKTIDWVAFGEIIPRNQEAIAISLKSWNDMLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFKKFNALKVPVPENKYTVQVDAEEKEDVKSCTEFLSRSKAR
IEEYVKELEKMKNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHKPIENL*
28 >lcl|XP_533119.2|Plus14254677..4255162 NW_876302 ATP synthase subunit d, mitochondrial-like LOC475912 __SEG__ Chr35 {Canis lupus familiaris} MAGRKLALKTIDWVAFGEIIPQNQKAIANSLKSWNEMLTSRLATLPEKPPAINWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTVQVDAEEKEDVKSCAEFLSLSKA
RIEEYEKELEKMKNIIPFDQMTTEDLNEVFPETKLDKKKYPYWPHKPIENL*
29 >lcl|XP_533315.2|Plus1complement(23955910..23956902) NW_876267 quinone oxidoreductase-like isoform 1 LOC476107 __SEG__ Chr19 {Canis lupus familiaris} MATAGKLMRAIRVFEFGGPEVLKLRSDVAVPIPKDHQVLIKVHACGVNPVETYIRSGTYRRKPLLPYTPGSDVAGIIEAIGENVSTFKKGDRVFTTATISGGYAEYALAS
DHTVYILPEKLDLKQGAAIGIPYFTAYRALLHSARAKAGESVLVHGASGGVGIAACQIARAYGLKVLGTAGTEEGQNIVLQNGAHEVFNHRELNYIDKIKKSVGEKGIDV
IIEMLANVNLSNDLDLLSYGGRVIVVGSRGPIEINPRDTIPKETSIIGTALYSSTKEEFRKFAMALQAGMEIGWLKPVIGPQYSLEKVVQAHENIIHSSGAIGKMILLLE
*
30 >lcl|XP_533418.1|Plus128301177..28302163 NW_876269 L-lactate dehydrogenase B chain-like isoform 1 LOC476213 __SEG__ Chr1 {Canis lupus familiaris} MATLKEKLIAPVAEEEATIPNNKITVVGVGQVGMACAISIVGKSLADELALVDVLEDKIKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNL
VQRNVNPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFHYFMAEKLGIHPSSCHGWILEEHGDSSVALWSGVNVAGVSLQELNPEMGTDNNSE
NWKEVHKMVVESAYEVIKLKGYTSWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILDARGLTSVINQKLKDDKFAQLKKSADTLWDIQKALKDL*
31 >lcl|XP_533575.2|Plus1complement(31637231..31637497) NW_876270 ATP synthase subunit f, mitochondrial-like LOC476372 __SEG__ Chr1 {Canis lupus familiaris} MASPVPVKEKKLMEVKLGDLPGCILMRDFTPKGIAGAFQRGYYWYCNMYINVNKGGVAGISMVLAAYVLFNYCRSYKELKHERLRKYH*
32 >lcl|XP_534178.1|Plus1complement(51842746..51843231) NW_876274 ATP synthase subunit d, mitochondrial-like LOC476978 __SEG__ Chr22 {Canis lupus familiaris} MAGRKLALKTIDWVAFGEIIPQNQKAIANSLKSWNEMLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKFPVLEDKYNVQVDAEEKEDVKSCAEFLSLSKA
RVEEYEKELEKMKNIIPFDQMTTEDLNEVFPETKLDKKKYPYWPHKPIDNL*
33 >lcl|XP_534921.1|Plus141853487..41853876 NW_876284 cytochrome c oxidase subunit 5B, mitochondrial-like LOC477724 __SEG__ Chr27 {Canis lupus familiaris} MASRLLRGVGALATQALRACGPNRVAVVRSMASGGGVPTDDEQATGLEREVMMAERKGLDPYNILAPKAAAGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEA
QQCPSCGTHYKLVPHQLAH*
34 >lcl|XP_535426.1|Plus14887163..4887648 NW_876294 ATP synthase subunit d, mitochondrial-like LOC478252 __SEG__ Chr30 {Canis lupus familiaris} MAGRKLALKTIDWVAFGEIIPRNQKAIANSLKSWNEMLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTVQVDAEEKEDVKSCAEFLSLSKA
RIEEYEKELEKMKNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHKPIENL*
35 >lcl|XP_538125.1|Plus1complement(28891236..28892240) NW_879563 L-lactate dehydrogenase B chain-like isoform 1 LOC481004 __SEG__ ChrX {Canis lupus familiaris} MATLKEKLIAPVAEEEAAIPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIAADKDYSVTANSKIVVVTAGVRQQEGESCLNL
VQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKRRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMG
TDNNSENWKEVHKMVVKSAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNTRGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
LKDL*
36 >lcl|XP_538308.3|Plus1230616..231416 NW_876251 protein SCO2 homolog, mitochondrial SCO2 __SEG__ Chr10 {Canis lupus familiaris} MLLLAWAPKPWHRLAHLKPSALRWTPGGRALHVSYGLLSMQGPEGTGRPSRPQGPGLRTRLLVTALFGAGLGGAWLAARKEKEQRQQQRRTEALRQAAVGQGDFSLLDHR
GHTRCKADFRGQWVLLYFGFTHCPDICPDELEKLVQVVRDLEAEPGLPPVQPVFITVDPERDTVAAMARYVQDFHPRLLGLTGSAEQVAQVSRSYRVYYRAGPKDEDQDY
IVDHSIAIYLLSPDGLFTDYYGRAASAQQIANSVRRHMAAFRSILH*
37 >lcl|XP_538480.1|Plus1complement(32325394..32326074) NW_876251 V-type proton ATPase subunit E 2 ATP6V1E2 __SEG__ Chr10 {Canis lupus familiaris} MALSDGDVQKQIKHMMAFIEQEANEKAEEIDAKSEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSTMRNQARLKVLRARDDLISELLNDAKLRLSRIVADPE
VYQGLLDKLVLQGLLRLLEPVVIIRCRPQDLLLVEAAVLKAIPEYMAVSHKCVEVQVDQEVHLSMNAAGGVEVYSGNQRIKVSNTLESRLDLLAQQKMPEIRKALFGANA
NRKFFI*
38 >lcl|XP_538742.2|Plus145547016..45548578 NW_876253 aldehyde dehydrogenase X, mitochondrial ALDH1B1 __SEG__ Chr11 {Canis lupus familiaris} MLRFLAPLAPRLLCLRGRTAPYSSAAALPSPILNPDIRYNQLFINNEWQDAASKKTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNR
LADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLS
ALYLASLIKEAGFPPGVVNVVTGYGPTAGAAIARHMDIDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSVVLADADMEHAVAQCHEALFFNMGQCCCAGSRTFV
QESIYDEFLERTVEKAKQRRVGNPFELDTQQGPQVDKEQFERILNYIRLGQKEGAKLLCGGERFGDRGFFIKPTVFGDVQDDMKIAREEIFGPVQPLFKFKKIEEVIERA
NNTRYGLAAAVFTQDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKIPQKNS*
39 >lcl|XP_539717.3|Plus132007372..32007854 NW_876259 ATP synthase subunit d, mitochondrial-like LOC482600 __SEG__ Chr15 {Canis lupus familiaris} MVGQKLALKTIYWVAFGEIISRNQKAIANSLKSRNETLTSRLATLPEKPPAIDWAYNKANVAKAGLVDDFEKKFNALKVPVPEDKHTVQVDAEKKDGKSCAKFLSLSKAR
TEEYEKELEKMKNIIPFDQMTIEDLNDVFPETKLDNKKYPYWPHKLNENL*
40 >lcl|XP_539718.1|Plus1complement(33629519..33630505) NW_876259 malate dehydrogenase, mitochondrial-like LOC482601 __SEG__ Chr15 {Canis lupus familiaris} MLSALARPAGASLRRSVSTSAQNNAKVAVLGASGGIRQIVSCLTLYDIAHTPRVAADLSHIETRATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNINASI
VDTLTAACAQHCPEAVICVISNPVNSTIPIATEVFKKHGAYDSNKIFGVTTLDIVRANTFTAELKGLDPARANVPVIGGHAGKTIIPLISQCTPKVDLPQDQLTAVTGQI
QEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAVNGKEGIVECSFVKSQDTDSDYFSTPLLLEKKGIEKNLGIGKISPFEEKMIAEAIPELKASIKKGEEFVKNMK*
41 >lcl|XP_541165.1|Plus1complement(46921741..46922868) NW_876269 lactate dehydrogenase A-like 6B isoform 1 LDHAL6B __SEG__ Chr1 {Canis lupus familiaris} MSWVVRALRGSRRAGAARVNRLCPQRPAGLSPAGAWAVVPASNMATVRGELLKNLTSEEVVHHNKVSIIGTGSVGMACAISILLRGLTDELALVDVNEDKLKAEMMDLQH
GSPFVKMPTIVSSRDYLVTANSSLVVITAGARQEKGETRLNLVQRNVAIFKLIISNIVQYSPHCKLIVVSNPVDVLTYVAWKLSEFPQNRIIGSGCNLDTARFRFLIGQK
LGIHSDSCHGWVLGEHGDTSVPVWSGVNIAGVPLKDLNSDIGTEKDPEQWKNVHKDVIASAYEIIKMKGYTSWAIGLSVADLTESILKNLRRVHPVSTIIKGLYEINEEV
FLSVPCVLGENGIADLIKIKLTPEEQARLKKSAKTLWEIQKELNL*
42 >lcl|XP_543473.2|Plus122983622..22983810 NW_876282 cytochrome b-c1 complex subunit 9-like isoform 1 LOC486347 __SEG__ Chr26 {Canis lupus familiaris} MAAPTFTARLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINQGVRDWAIPDLGPA*
43 >lcl|XP_544307.1|Plus1complement(1619418..1620323) NW_876292 mitochondrial ornithine transporter 1 SLC25A2 __SEG__ Chr2 {Canis lupus familiaris} MKSNPAVQAAIDLTAGAVGGTACVLTGQPFDTVKVKMQTFPGLYKGLVDCCLKTYSQVGFRGFYKGTGPALMAYVAENSVLFMCYGFCQQLVRKVVGLDEQEKLTDLQAA
AAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSQNTIWSVVKSILRKEGPLGFYHGLSSTLLQEVPGYFFFFCGYELSRSFFASGRSKDELGPVPLMLSGGIAG
ICLWLVIYPVDCIKSRIQVLSISGKQAGFLGTLLSVVKNEGTAALYSGLTATMIRAFPANGSLFLAYEYSRRMMMNQFEAY*
44 >lcl|XP_545842.1|Plus111676083..11676382 NW_876307 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2-like LOC488724 __SEG__ Chr3 {Canis lupus familiaris} MAAATASLRIGAKVAPREIRVHLCQCSPGSQGVREFIEKHYVELKKATPDLPILTSECSDVQHKLWTRYAFAREKNVSLNSLSADQVTRAVDNVLSGKA*
45 >lcl|XP_848816.1|Plus15680454..5680717 NW_876288 ATP synthase subunit f, mitochondrial-like LOC607375 __SEG__ Chr29 {Canis lupus familiaris} MASSVPMKEKKLMKVKLGELPGWMLMRDSTPKGTAGAFQRGYYQHYKYINVKKGGAAGISMVLAAYVLFNYCRSYKELKHEQLRKYH*
46 >lcl|XP_849412.1|Plus11689604..1689870 NW_876292 ATP synthase subunit f, mitochondrial-like LOC607581 __SEG__ Chr2 {Canis lupus familiaris} MASPIPVKEKKLMEVKLGELPGSILMQDFTSKGITGAFQRGYYGYYNKYINVKKGGVAGISMVLAAYVLFNYCCSYKELKHQQLRKYH*
47 >lcl|XP_849537.1|Plus1complement(14978184..14978450) NW_876305 ATP synthase subunit f, mitochondrial-like LOC607698 __SEG__ Chr38 {Canis lupus familiaris} MASPIPVKEKKLMEVKLGELPGWILMRDFTPKGIAGAFQRGYYRYYNKYINVKKGGVAGISMVLAAYVLFTYCGSYKELKHERLHKYH*
48 >lcl|XP_849957.1|Plus1complement(9736718..9737359) NW_876251 ATP synthase subunit O, mitochondrial-like LOC608258 __SEG__ Chr10 {Canis lupus familiaris} MAAPAVSGLSRQVRCFSTSVVRPFSKLVRPPVQIHGIEGRDATALYSAASKQNKLEQVEKELLRVAQILKEPKMAASIMNPYIKRSVKVKSLNDVTAKERFSPITSNLIN
LLAEKGRLNNTPGVISAFSTMMSVHRGEVPCTVTTASPLDEATLTELKTVLKSFLSKGQVLKLEVKVDPSIMGGMIVRIGEKYADMSAGTKIQKLSRAMREVF*
49 >lcl|XP_849958.1|Plus111018862..11019128 NW_876253 ATP synthase subunit f, mitochondrial-like LOC608048 __SEG__ Chr11 {Canis lupus familiaris} MASPVPVKEKKLMEVKLGELPGWILMQDFTPKGIAGAFQRGYYRYYNKYINVKKGGFAGISMVLAAYVLFNYCHSYKELKHERLRKYH*
50 >lcl|XP_850262.1|Plus15311207..5312049 NW_876258 succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial SDHB __SEG__ Chr14 {Canis lupus familiaris} MAAVVGVSLKRRFPAAALGGACLQACRGEQTAAATAPRIKKFAIYRWDPDKTGDKPHMQTYEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNT
LACTRRIDTNLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDRLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMI
DSRDDFTEEHLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKGKKASV*
51 >lcl|XP_852209.2|Plus126715462..26716094 NW_876273 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial-like LOC476824 __SEG__ Chr21 {Canis lupus familiaris} MRCLTMPTLLQTLAQAAPAGHPTARSLHSSTVAATYKFVNMREPSMDMKSVMDRAAQTLLWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEER
CIACKLHEAVCPAQAITIQAEPRADGSRRTTRYDIYMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLSNGDKWGAEVAANIQADYLYC*
52 >lcl|XP_852794.1|Plus1complement(10354941..10355525) NW_876251 histone H1.0-like LOC610251 __SEG__ Chr10 {Canis lupus familiaris} MTENSTSTPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKRSVAFKKT
KKEVKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKTKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRTGKKK*
53 >lcl|XP_853526.1|Plus155915673..55915939 NW_876253 ATP synthase subunit f, mitochondrial-like LOC610712 __SEG__ Chr11 {Canis lupus familiaris} MTSSVPVKEKKLMEVKLGELPGCILMRDFTPKGIAGTSQRVYYRYYNKYINVKKGGFAGISMVLAAYVLFNYCRPYKELKHERLRKYH*
54 >lcl|XP_853952.1|Plus1complement(42105012..42105467) NW_876284 cytochrome c oxidase subunit 5A, mitochondrial-like LOC610768 __SEG__ Chr27 {Canis lupus familiaris} MLGAALRRGTVAAAAARASPQGLRYPAPAPSPATAVQSVRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRIL
EVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV*
55 >lcl|XP_857183.2|Plus1complement(7022065..7023054) NW_876288 L-lactate dehydrogenase B chain-like isoform 2 LOC477883 __SEG__ Chr29 {Canis lupus familiaris} MATLKEKLIAPVAEEAAIPNNKITIVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGCLFLQTPKIVADNDYSVTANSKIMVVTAGVRQQEGKSHLNLV
QRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFHYLMAEKLRIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGT
DNDSENWKEVVESAYEVIKLKEYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIKSEVFLSLPCILNARGLTSVINQKLKDNEVAQLKKSADTLWDIQKDLKDM*