SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor B    

ID / Description / Sequence
1 >lcl|NP_001007715.1|Plus1complement(588381..589247) NW_048046 mortality factor 4 like 2 Morf4l2 __SEG__ ChrX {Rattus norvegicus} MSSRKQASQTRGQQSAEEDNFKKPTRSNMQRSKMRGAASGKKSAGSQPKNLDPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEVPQPPRKKRARADPTVE
SEEAFKSRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMS
QIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL*
2 >lcl|NP_001011999.1|Plus1complement(8525966..8526904) NW_047399 mortality factor 4 like 1 Morf4l1 __SEG__ Chr13 {Rattus norvegicus} MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDANLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKT
KTNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFLSSCQEECGFHFGGLCKL*EVSRKYR**GVCC**GCGG
DKGVLQCNVGHSATLQI*ETTVC*NSGRSPGCTHVPGCELERCWPIHL*MRKALLYY*TIYMISSSTWQRILQLCSVPVIMKWLLLSTIGKPC
3 >lcl|NP_001012036.1|Plus1complement(2944487..2945899) NW_047424 something about silencing protein 10 Utp3 __SEG__ Chr14 {Rattus norvegicus} MVKRSRRRGAAQWATVRAKAGRTATDENEDDLGSPPSPGDSSYYQDQVDEFHEARSRAVLAKGWNEVESGEEDDDEEEEVLPLNIDDENDEDGESSEEEEDGEDDDGGSS
VQSEAEASVDPSLSWGQRKRLYYDTDYGSKSRGRQSQQEVEEEEREEEEEAQVIQRRLTQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESP
ELLELIEDLKVKLTEVKDELEPLIQLVEKGVIPPGKGSQYLKTKYNLYLNYCANISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTAKEGAGK
KDLNPKAKLTKTKPKSAKQTDVNADLTEEPEFDEAALEFYKEMEDRPELKRKKEENSAEEQALEEQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRG
QVREVRREEQRYSGELSGIRAGVKKSIKLK*
4 >lcl|NP_001014054.1|Plus115796011..15797126 NW_047601 male-specific lethal 3-like 2 Msl3l2 __SEG__ Chr20 {Rattus norvegicus} MATLGCAPKDDGEGKDEGGSDRGDGDPKPKGKKEVEAHTRREADERAVRIPIPEVLQQRLADDCYYINRRRRLVRLPCQTNVGAILECYVRHFSASALASGDRRPQPQRA
APERSVGLCREMADGLRITFDHALPLVLLYPQEQAQYEMVTSSTFFFPTEERASDAGRSQEAPWPGPSPPQPSESQAMAGPTAPKRRRVETDAARAPRRSTRHSTHCHWQ
AEDRASPQAKRSVPKLFPHLQKTPVHSTALSPIALTPGKEGSAMFAGFEGTTEEINEILSWKLVPDNYPPGHQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKAL
LKHLDLFLRFLAEYQADFFLESAYVSACEAHYSSKNPRTIC*
5 >lcl|NP_001019453.1|Plus11855772..1856164 NW_047492 Histone H2a RGD1564767 __SEG__ Chr17 {Rattus norvegicus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLYKGNYSERVGASAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKSKGK*
6 >lcl|NP_001019960.1|Plus1complement(2642608..2643993) NW_048043 nucleosome assembly protein 1-like 2 Nap1l2 __SEG__ ChrX {Rattus norvegicus} MAESAEHKELSDSNQEELGSQVMAEGPGGSQDCSEGVSTEPGDGGQQGEETVAAGVEEEGKGEEAAAGSGEDAGKRGGAAEDSDSDRPKGLIGYLLDTDFVESLPVKVKY
RVLALKKLQTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEYKSDCEDYFEEEMDEEEETNGNEEGMVHEYVDEDDGYEDCYYDYDDEEEEEEE
EDESAGATGGEAVNEEDPKGIPDFWLTVLKNVEALTPMIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLACYDPHPYRGTAIEYAT
GCHIEWNEGKNVTLRTIKKKQRHRVWGTVRTVTEDFPKDSFFNFFSPHGISLNGGDENDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDEIYDKIIYDDWMA
AIEEVKACCKNLEALVEDIDR*
7 >lcl|NP_001033680.1|Plus1complement(628389..629093) NW_047477 inhibitor of growth family, member 1 Ing1 __SEG__ Chr16 {Rattus norvegicus} EILKELDDYYEKFKRETDSTQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDISDGTGGGGKAGQDKSKSEAITQADKPNNKRSRRQRN
NENRENASNNHDHDDITSGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGESEKTMD
KALEKSKKERAYNR*
8 >lcl|NP_001037758.1|Plus1complement(6093453..6093920) NW_047693 nucleosome assembly protein 1-like 5 Nap1l5 __SEG__ Chr4 {Rattus norvegicus} MADPEKQGPAESRAEDEVMEGAQGGEDAATGDSATAPAAEEPQAPAENAPKPKNDFIESLPNPVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQEL
TGEMEGCAWTLEGEDDEDDEEEEDEEEEEEEAAAGATGGPDSAEK*
9 >lcl|NP_001098082.1|Plus1complement(7423071..7424744) NW_047780 jerky homolog Jrk __SEG__ Chr7 {Rattus norvegicus} MASKQAAAKGKGEKRKRVVLTLKEKIDICSRLERGESRKALMQEYNVGMSTLYDIKAHKAQLLSFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGP
MLIEKAKDFYKQMRLTEPCVFSGGWLWRFKARHGIKKLDASSEKQVADPQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPSSTPDDGTVPRFKQGKDRLTVLM
CANATGSHRIKPLAIGKGGGPRAFRGIQHLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHPQESELVSENVFTIFLPSSVTSLLQP
TEQGIRRAFMRLFINPPVALQGFPTRHNVNDAIVNVACAWNAVPSQVFRRAWRKLWPTVPFTEGSSSGEEAECCSIKPHKTFAHILELVKEGPSCSGSRLQDSRVEERLV
SGRDMDEAPAVVAPSQTTGCAEKSEKDAGEDEETVWEQAATSFEALVRFAERQPCFSVQEVGQLQALHTVFRRQQQLRQPRVALRAVIKLEALQEHPGVCMATAHSALPC
SSTAGDN*
10 >lcl|NP_001100235.1|Plus1complement(13774672..13777455) NW_047773 hypothetical protein LOC299557 RGD1310212 __SEG__ Chr7 {Rattus norvegicus} MALVPVYCLCRQPYNVNHFMIECDLCQDWFHGSCVGIEEEKAVDIDIYHCPDCEVIYGPSIMKKWPASSKEHEALKREPVKTGSPIFIHQLQGKTFDSSDEVILKPTGSQ
LTVEFLEESSFSIPILVLKKNGLGMTLPPTSFTVRDVEQYVGSDREIDVIDVACQASSKMMLGDFVKYYYSRRREKVFNVINLEFSNTRLSNTVEMPKIVRKLSWVENLW
PEECGFERPTVQKYCLMSVQNSYTDFHIEFGGTSIWYHVLKGEKIFYLIHPTDANLTLFKCWSNSSNQKEMFFGDQVDKCYKCSVKQGQTLFIPTGWIYAVLTPVDCLAF
GGNFLHSLNIEMQLKAYETEKHLSTAHLFKFPSFETICWHVGKHMLDIFEGLRENGRYPAPYLVRGGKALNLAFQAWTRKEVLPDHEDEIPKTVQTVQLIEDLAREICLV
EDTSQQSIPKTSTIFGLQQHHTNPSSLNRQTHSTSVSTSTLSLPSKSGSEKKSPKYKDIFKKEEQTSKERPTLGPNDQHSCNFMDLNNHQELKVGFSQNVECNITSTCLN
DSDDDSKFDKVCDGNESLVPLLMANGSTKRVKSLSNSWRAKITKKEDKSKLVEEKKMGDKFDLDTNDELQTEKRLGKVKDSLVVRSKIPPNLPHVKFCSHQNQSCEPGET
EIDIVENYKIDEGMMEGVEGKLKNGGESDGILDLLKARKQVGGPGYVVLTDAPDYSSSKENTQDTVFMAELQSSSPSPAPSTLHTLWSGGQDQGYESSSSGLGTVFNSPV
SQQTRRKWPIKRLTYWRTESEEENACVDEQDGLGACFKQVKYIYLSLESDDDDDDDDDDDDSVLRSLSKKRKVSDNVPWIPRTGEIQTLLEQDHPVLEGTRVTSIEIGLA
TAATKLSQQVNNMKLTLISPGKKTASKQRQSDLNPCPQTSAFLLLDP*
11 >lcl|NP_001100273.1|Plus113231011..13231571 NW_047798 methyl-CpG binding domain protein 3-like 1 Mbd3l1 __SEG__ Chr8 {Rattus norvegicus} MGKTSQRKQCDCENPSKPCLSTSIPLRMSNYTFKRPVTKITSHLGNEVRYYQWEETLEKPEQACWQKRLQGLQAYSSAGEILSTSDLSKALKDLTPRDTDAASSIIQANS
MDPRPLSTLGSSSHLAKMIPEAGPQILCKEFLVTEEDISIQERKVKIARERLAVALIAHKLANETEKVRGSRKAKV*
12 >lcl|NP_001100439.1|Plus117473015..17473365 NW_048043 H2A histone family, member B3 H2afb3 __SEG__ ChrX {Rattus norvegicus} MPRTTENSLRGSSSRRRRRSRTSRAELIFAVSLVEQHLREGGHARRRLSETVPIFLAAILEFLTRRLLELAGNEAQRRGTQSRITPELLDLAVYSNTLLSELFQFITISR
VAPAHH*
13 >lcl|NP_001100822.1|Plus11791759..1792139 NW_047492 histone cluster 1, H2bh Hist1h2bh __SEG__ Chr17 {Rattus norvegicus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
14 >lcl|NP_001101043.1|Plus1complement(17052134..17053546) NW_047563 tigger transposable element derived 3 Tigd3 __SEG__ Chr1 {Rattus norvegicus} MELNTKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANHERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELA
DIMGQDFVPSIGWLVRWKRRNNVGFGTRQVLVPLLPPEPPPAVSPSQAQPPLSLKDFSPEDVFGCAEVPLLYRAVPGRVFECDRLQVLLCANSRGTEKRRVFVGGLQPAP
RCFFGVNSEALPASYHPDLAIPWSEWLAQFDQDMGQQGRQVALLLASGVVEEWASPPGLHHVRLLPLSTSSTTPSLPGSVVLAFKAHYRHRLLSKLAAMQSGKEGTSRAE
ARANITVLDALHMVAAAWAKVPRQLILTSFIQEGLAPGKTPLSLDKDTEMSPVPSGLSQEEFSHFVDLEDEDPGPRVCKEETSTEDNGREEDGFESLPTKADALRALCTL
RRWLECNSTSPELFEKFYDCEVEVEQLCCL*
15 >lcl|NP_001101168.1|Plus117502484..17502894 NW_047626 histone cluster 2, H3c2 Hist2h3c2 __SEG__ Chr2 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
16 >lcl|NP_001101592.1|Plus1complement(6799800..6801374) NW_047798 jerky homolog-like Jrkl __SEG__ Chr8 {Rattus norvegicus} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEEFCNHFRDFIEQENLQPEQIYNADETGLFWKCLPSRTAVVKGKCTVPGHNSGEERITVMCCTNATGL
HKLKLCVVGKARKPRSFKSTDTFNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLKSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGV
IATMKRNYRAGLLHNNLEEGNDLKSFWKKLTLLDALYEIAMAWNFVKPVTISRAWKQILPAMEEKEGLDFDEEDISGATVATILQHTKGLENVTPESLEKWLEIDSTEPG
YEVLTDSEIIRRAQGQTDESSENDEEGIELIPEKHINHTTALQWTENLLDYLEQQGDMILPDRLVIRKLRATIRNKQKMTNPSQ*
17 >lcl|NP_001101884.1|Plus1complement(3771365..3771745) NW_047492 histone cluster 1, H2bm Hist1h2bm __SEG__ Chr17 {Rattus norvegicus} MPEPTKSVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
18 >lcl|NP_001102761.1|Plus116931881..16932312 NW_047799 H2A histone family, member X H2afx __SEG__ Chr8 {Rattus norvegicus} MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTSATVGPKAPAGGKKASQASQEY*
19 >lcl|NP_001102843.1|Plus1complement(379842..380486) NW_047537 high mobility group box 1 like Hmg1l1 __SEG__ Chr19 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIPAYRAKGKPDAAKKGVVKAEKSKKKKEEEDNEEDEEDEEEEEEEEDEDEEDDDDE*
20 >lcl|NP_001102870.1|Plus1complement(3460874..3461254) NW_047492 histone H2B LOC680312 __SEG__ Chr17 {Rattus norvegicus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSAK*
21 >lcl|NP_001102893.1|Plus1complement(3778430..3778822) NW_047492 similar to histone 2a LOC680615 __SEG__ Chr17 {Rattus norvegicus} MTGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
22 >lcl|NP_001103035.1|Plus1459238..459747 NW_047337 histone linker H1 domain, spermatid-specific 1 Hils1 __SEG__ Chr10 {Rattus norvegicus} MSLVSPSPDSNAVMAGDQDASTSQVPSQSESKIGPNVATQTLRKPTMSKVILRTVADKGVHSRVSLAALKKAVSITGYNMAQNTWRFKRVLQNLVKKGMLKQVTGKGASG
SFRLGKKQAFKSKCKAKRRQRRQKPGQRRTGSRRSLLGSKKSNNRLFKGVRRVAKGRRH*
23 >lcl|NP_001103080.1|Plus126922477..26922866 NW_047696 H2A histone family, member J H2afj __SEG__ Chr4 {Rattus norvegicus} MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESQKVKSK*
24 >lcl|NP_001103111.1|Plus1complement(32068955..32069335) NW_047334 histone cluster 3, H2bb Hist3h2bb __SEG__ Chr10 {Rattus norvegicus} MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
25 >lcl|NP_001103112.1|Plus132076730..32077140 NW_047334 hypothetical protein LOC691496 LOC691496 __SEG__ Chr10 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYHPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
26 >lcl|NP_001104597.1|Plus132061890..32062270 NW_047334 histone cluster 3, H2ba Hist3h2ba __SEG__ Chr10 {Rattus norvegicus} MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
27 >lcl|NP_001104811.1|Plus117444000..17444392 NW_047626 hypothetical protein LOC690102 LOC690102 __SEG__ Chr2 {Rattus norvegicus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTDSHKPGKNK*
28 >lcl|NP_001116941.1|Plus1complement(17496828..17497139) NW_047626 histone cluster 2, H4 Hist2h4 __SEG__ Chr2 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
29 >lcl|NP_001119740.1|Plus18488375..8490303 NW_047780 tigger transposable element derived 5 Tigd5 __SEG__ Chr7 {Rattus norvegicus} MYPASPSAGPALHPVPHRARLPRPRCLAEPPRSPAPGPGSTARPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWF
LDQLGGEVGTQRKKMRLANEEEIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPPVAGPAPVKEEPAQPSSAG
LLLDGTPATLPHSEGGYGDEQIYNANVTGLYWRLLPEQNATPGTGDSREPGECSRRWCSDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWL
SRPLLRGWFFEEFVPGVKRYLRRSCLQQKAVLLVAHPPCPSWTTSMPAVEESEGTPRQCQPELLGSPEELQTPDGAVRVLFLSRGNSRAHIPAPLEHGVVAAFKHLYKRE
LLRLAVSCASGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPGQQPAHQVEEAAEHSRMLSDLTHLAALAYKRLAPEEVAEWLHLDDDGGLPEGCGE
EVAPAAPPSPASLPSSIGAGEEEEEEATEQGGVLVPTAGEAVWGLETALRWLESQDPREVGPLRLVQLRSLITMARRLGGIGPSAAASDDGV*
30 >lcl|NP_001128070.1|Plus1complement(12561121..12561474) NW_048034 hypothetical protein LOC367734 RGD1563155 __SEG__ ChrX {Rattus norvegicus} MSGKKSQEKACSDNKQTEDPSSRPEVQVPVNYVYRLLQEEQYTPCLGSTTSDFLLAMLDYLTDYILEVVGSEANINSQQNISQDRERQRENDREPPQAFKNAPFSLFDEM
PGPRRNG*
31 >lcl|NP_068611.1|Plus1complement(1631626..1632018) NW_047492 histone H2A type 4 Hist1h2aa __SEG__ Chr17 {Rattus norvegicus} MSGRAKQGGKARAKAKSRSFRAGLQFPVGRVHRLLRQGNYAERIGAGTPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKSQTK*
32 >lcl|NP_068612.2|Plus132069642..32070034 NW_047334 histone H2A type 3 Hist3h2a __SEG__ Chr10 {Rattus norvegicus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
33 >lcl|NP_072169.1|Plus11632324..1632707 NW_047492 histone H2B type 1-A Hist1h2ba __SEG__ Chr17 {Rattus norvegicus} MPEVSAKGTTISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAK
HAVSEGTKAVTKYTSSK*
34 >lcl|NP_072173.1|Plus12113971..2114351 NW_047492 histone H2B type 1 Hist1h2bl __SEG__ Chr17 {Rattus norvegicus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
35 >lcl|NP_073177.1|Plus13455616..3455927 NW_047492 histone cluster 1, H4b Hist1h4b __SEG__ Chr17 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
36 >lcl|NP_596893.1|Plus1complement(23759358..23760968) NW_048043 nucleosome assembly protein 1-like 3 Nap1l3 __SEG__ ChrX {Rattus norvegicus} MAEADPKMVTEPAAQGVAEEAMASSACDSGDESDSNSSSSTTSCGSTGSSSSSSSSSSSSSSSSSGSSGSSSNGSHLHQKKRVPGPSRRAQRRPSGKLFMDKLPQAVRNR
VQALRNIQNECDKVDTLFLRAIHDLERKYAELNKPLYDKRFQIINAEYEPTEEECEWNSEEEFSGDEEMQDDTPNEMPPLEGEEEEEIGKENTEVKEEVKDVPEEVPEAK
VEEEEAPKETSEVKTEEKEIPKEGPEEKAEEQESSKEFPEVKVEEKTDSTDCIDIAPEEKEDLKDVTQANAEYTDQPTEDSTPRAPVREAQKRVPETRPEERVNIKRARK
GKPKKEDPPRGIPDYWLTVLKNVDKLGPMIQKCDEPILKFLSDVSLKFSNPGQPISYTFEFHFLPNPYFRNELLMKTYIIRSKPDHYDPFFAWGWEIEECKGCKIDWRRG
KDVTVTTRSRPAITGEIEVQPRVVPNASFFNFFSPPEIPLIGKLEPKEDAILDEDFEIGQILHDNVILKSIYYFTGEINDPYYHDFRDYGNRKYYK*
37 >lcl|XP_001054684.1|Plus1complement(1807743..1808057) NW_047492 histone H4 replacement-like LOC679840 __SEG__ Chr17 {Rattus norvegicus} MSGRGKGGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
38 >lcl|XP_001054927.1|Plus1complement(1855091..1855471) NW_047492 histone cluster 1, H2bd-like Hist1h2bb __SEG__ Chr17 {Rattus norvegicus} MPEPSKSAPAPKKGSKKAISKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
39 >lcl|XP_001055051.1|Plus11856863..1857273 NW_047492 histone cluster 2, H3c2-like LOC679950 __SEG__ Chr17 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
40 >lcl|XP_001055174.1|Plus1complement(1865810..1866121) NW_047492 histone H4 replacement-like LOC679983 __SEG__ Chr17 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
41 >lcl|XP_001055231.1|Plus1complement(1866711..1867121) NW_047492 histone cluster 1, H3f-like LOC679994 __SEG__ Chr17 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
42 >lcl|XP_001055696.1|Plus1complement(2117831..2118142) NW_047492 histone H4 replacement-like LOC680097 __SEG__ Chr17 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
43 >lcl|XP_001056658.2|Plus13461578..3461964 NW_047492 histone cluster 1, H2ae-like LOC680322 __SEG__ Chr17 {Rattus norvegicus} MSGRGKQGSKARAKAKTRSFRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKVK*
44 >lcl|XP_001057044.1|Plus1complement(3672284..3672664) NW_047492 histone cluster 1, H2bd-like Hist1h2bc __SEG__ Chr17 {Rattus norvegicus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
45 >lcl|XP_001057149.1|Plus1complement(3681247..3681558) NW_047492 histone H4 replacement-like LOC680430 __SEG__ Chr17 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
46 >lcl|XP_001057443.1|Plus13696457..3696867 NW_047492 similar to CG31613-PA LOC680498 __SEG__ Chr17 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVIALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
47 >lcl|XP_001057500.1|Plus13699999..3700409 NW_047492 histone cluster 1, H3f-like LOC680511 __SEG__ Chr17 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
48 >lcl|XP_001064282.1|Plus1complement(1461346..1461852) NW_048049 high-mobility group box 4-like LOC685552 __SEG__ ChrX {Rattus norvegicus} MGKDSKVRPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQREMRNYSGPRRERRRRDPDAPRKPPSSFLLFSQDHFEE
IKEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAYYQQCQRGK*
49 >lcl|XP_001068941.1|Plus1complement(42260411..42261055) NW_047625 high mobility group box 1 LOC689398 __SEG__ Chr2 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEVSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTASDDKQPYEKKAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDE*
50 >lcl|XP_001070681.2|Plus134602733..34603119 NW_047760 H2A histone family, member V-like LOC689408 __SEG__ Chr6 {Rattus norvegicus} MAGGKAGKDNGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRATSRGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPSHLQLAIRGDEELDSLINATIAGGGV
IPHIHKSLIGKKGQQKTA*
51 >lcl|XP_001073395.1|Plus1complement(17466047..17466439) NW_047626 histone cluster 2, H2aa3-like LOC690131 __SEG__ Chr2 {Rattus norvegicus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
52 >lcl|XP_001074673.1|Plus134939912..34940553 NW_047658 high mobility group box 1 LOC690521 __SEG__ Chr3 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFLFCSEYRP
KIKGEHPALSIGDVTKKLGEVWTNTASDDKQPCEKMAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAERSKKKKEEEDDEEDEDDEEEEEEEDEDDEEDDDDE*
53 >lcl|XP_001076232.1|Plus1complement(68369..69013) NW_047674 high mobility group box 1 LOC690940 __SEG__ Chr3 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEVSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTASDDKQPYEKKAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDE*
54 >lcl|XP_001076590.1|Plus1631982..632488 NW_048032 high-mobility group box 4-like LOC691030 __SEG__ ChrX {Rattus norvegicus} MGKDSKVRPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQREMRNYSGPRRERRRRDADAPRKPPSSFLLFSQDHFDE
IKEQHPNWTVGQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAYHQQCQRGK*
55 >lcl|XP_001076648.2|Plus1<1113849..1114367 NW_048032 high-mobility group box 4-like LOC691047 __SEG__ ChrX {Rattus norvegicus} HGKEVHSRPKVNVSSYIHFMLNFRDQVKEQQPNTYHHFASFSRKLSEKWRSISKPENVENEALDKLNKGQYKDKMRNYRRKRRKRRRDANTLHKPPSSFLMFSLDHFTQL
KKENTKWTVVEVAKPARMIWSMSTNVNKISFEQKAVLLQPKYLEKWEAYCHQCQGKKSNFFG*
56 >lcl|XP_002728100.1|Plus1complement(188072..188491) NW_047401 GL16668-like LOC678708 __SEG__ Chr13 {Rattus norvegicus} MTRTKQTARKFTSGKAQCKQLATKAIRKSARAIGGVKKPYRYCPGTCTVVLPEIRHYQKSTELLICKLLFQAGPGAGDWEIVQDFKTTCVSRARRSWPCKKRVRPNLWVC
LRTPTCAPFTPSVSPSCPRTSSQPASFVV*
57 >lcl|XP_002728414.1|Plus116514382..16515461 NW_047469 serologically defined colon cancer antigen 3 LOC100363321 __SEG__ Chr16 {Rattus norvegicus} MSGYARRQGAPPLSRTRSLVVPDGDKLEDLEEANPFSFKEFLKTKNLSLSKEDTATSRIYPKEASRHPLGLDHNSPVSQPMGYGLEYQQPFFEDPTRASNLEEDEEDGWS
RAYLPSAVEQTHSTRATQNSSPCGTYLSFFSNASELAGPESLPPWTLSDTDSRLSPASPAGNPNVDFAAHEESLGDRHLRTLQLSYEALKDENSKLRRKLSEVQSFSETQ
TEMVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAENHVMKLKQEVNLLQAQLSNFKRENEALRSGQGASLTVVKQNTDVALQNLHVVMNSAHASIKQL
VSGAETLNLVAEILKSIDRITEVKDEADS*
58 >lcl|XP_002728446.1|Plus1complement(4442995..4443546) NW_047471 chromobox homolog 3-like LOC100360260 __SEG__ Chr16 {Rattus norvegicus} MASNKTTLQKMGKKQNGKSKKAEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDA
ADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEVNMKCPQIVIAFYEERLTWHSCPEDEAQ*
59 >lcl|XP_002728525.1|Plus13694861..3695253 NW_047492 histone cluster 1, H2ae-like LOC100360754 __SEG__ Chr17 {Rattus norvegicus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
60 >lcl|XP_002728528.1|Plus13733374..3733685 NW_047492 histone H4 replacement-like LOC100361076 __SEG__ Chr17 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
61 >lcl|XP_002728541.1|Plus1complement(1848036..1848446) NW_047492 histone cluster 1, H3f Hist1h3f __SEG__ Chr17 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
62 >lcl|XP_002728547.1|Plus1complement(3453313..3453693) NW_047492 histone cluster 1, H2bc-like LOC100359692 __SEG__ Chr17 {Rattus norvegicus} MPEPAKSVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREVQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
63 >lcl|XP_002728910.1|Plus1complement(21325468..21325878) NW_047563 histone H3.3B-like LOC686736 __SEG__ Chr1 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKASHKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRILGERA*
64 >lcl|XP_002729365.1|Plus1<6510178..6511356 NW_047693 rCG52281-like RGD1559612 __SEG__ Chr4 {Rattus norvegicus} IPKAAGKGTKLKGDETAASEFCGNFQEFVKRENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGLHKLNLCVVGKAKRPRAFKGTDLSN
LPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLNSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMDEGNDPK
LFWKNLTVLDAIYEASRAWNQIRSSTITRAWRKLFPGNEENPSVSIDEGAILAANLATVLQNTEDCEHVNIENIGQWFDSRSSGSNCQVLADLVGAADRAKAGEQKQPSR
KTRKAELNPEKHISHRAALEWTENLLDYLEQQDDMLLSDKLVLRRLRTIIRRKQRIQTKSHL*
65 >lcl|XP_002729533.1|Plus1complement(8057841..8058389) NW_047713 chromobox homolog 3-like LOC100360453 __SEG__ Chr5 {Rattus norvegicus} MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKRDAA
DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ*
66 >lcl|XP_002729863.1|Plus18687183..8687593 NW_047779 histone H3.3B-like LOC100360868 __SEG__ Chr7 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKATRKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
67 >lcl|XP_002729864.1|Plus18687993..8688403 NW_047779 histone H3.3B-like LOC100360975 __SEG__ Chr7 {Rattus norvegicus} MARTKQTARKSTGGKAPRKQLATKASHKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
68 >lcl|XP_002729955.1|Plus1complement(33143337..33143747) NW_047799 histone H3.3B-like LOC100361110 __SEG__ Chr8 {Rattus norvegicus} MARTKQTACKSTSGEAPRKQLATKAARKSAPSTGGVKEPHRYRPGTVALSEIRCCQKSTELLIRKLRFQCLVREMAQDFKTALRFQEAAIGVLQQASEAYLVGHSEDTNL
CAIHAKHVTIMPKDIQLARHIRGEHA*
69 >lcl|XP_002730243.1|Plus1complement(12558467..12558895) NW_048034 rCG42854-like LOC100363125 __SEG__ ChrX {Rattus norvegicus} MEGKRQNNAARSSRGKLHFPVNKVERLLRERNTSKCPNSSAPVFLAGVLEYLTSNILDLAGKEAHNSGSKLISPEHVTMAIRKNEGFHQLLKDNKWLAGEIPGPSGTSAL
NKRSALKRPTPDEITEPDETPAPSGTPAPDKK*
70 >lcl|XP_002730244.1|Plus1complement(13112111..13112437) NW_048034 histone variant H2al2-like LOC100363171 __SEG__ ChrX {Rattus norvegicus} MAGKRRRRNISRSRRAELQFPVSRVDRFLREGNYSRRLSSSAPVFLAGVLEYLTSNILELAGEEAHTSGRKRISPEHLCRVVQNNDQLHQLFKEGTKSVFESADPDEN*
71 >lcl|XP_225376.4|Plus1complement(3485718..>3487055) NW_047492 transcriptional adaptor 3 Tada3lb __SEG__ Chr17 {Rattus norvegicus} SEHSREGPISWAMSELKDCPLQFHDFKSVDHLKVCPRYTAVLAHSEDDGIGIE*LDTLQLELETLLSSASRRLRVLEAETQILTNWQDKKGDR*FLKLGRDHELGVPPKH
GKHKKQKL*GKTGHGPSPGPGRPKSKNVQPKIQKY*FTDDPIDVPRIPKNDAPNRFWASVEPYCANITSEEVRTLEELLKPPKDEAEHYKIPPLGKHYSQRWSQEDLLEE
QKDVTQAAAVADKKKGLIELLTELDTKDVDALLKKSEAQHEQPEDRCPFGALTQRLLQVLVEENIISSMEDSPIPDMSGKESGADGATPPSPRNQNKPFIVPHTKSLESR
IKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKKEVSLEELRQRVRMADNEVMDAFRKIMAAWQKKRTPTKKEKD*AWKTLKDRKRIL
KLLDG*
72 >lcl|XP_225382.1|Plus13674504..3674815 NW_047492 histone cluster 1, H4m Hist1h4m __SEG__ Chr17 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
73 >lcl|XP_225384.1|Plus13685135..3685515 NW_047492 histone cluster 1, H2bp Hist1h2bp __SEG__ Chr17 {Rattus norvegicus} MPETAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
74 >lcl|XP_226650.1|Plus19065396..9066475 NW_047616 Arid4a protein-like RGD1564961 __SEG__ Chr2 {Rattus norvegicus} MEGTTGVSQERSGDGDGVGAEGMKGVHVEQHFETESEGMPLLTAEPDQGIPEVTSEKSDSSAEELVHMPLKEEERVMPLIGPETLVDLDDLDERDKPSIEDVIVEGSESN
SLGSVLPDLPSVSQHSFSVALPLTSSQDESRGIKSEGDITIEVDSIAEESQEGLCERESANRSEASVASGTCGIITRERKRRAKGQKRPSDANSVLMTKKQKQTPKRTSA
AAKSEKNGAGQSSDSEDLPATDSSSNSTPVKHLNLPKPQKLPRSPARVSLLKDRGKEKHKEKPADSSPRTYKWSFQLNELDNMNSIERLSFLQEKAQEIRKHYMSLKLEV
ATIDRRRKSLKRKDREVSHTGPSSMSSAS*
75 >lcl|XP_227318.1|Plus12790919..2792463 NW_047626 tigger transposable element derived 4 Tigd4 __SEG__ Chr2 {Rattus norvegicus} MAEASLDAGTPPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPML
RLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGVSTDPSAVWYQNVLPYYLNDYHPKNIFNVKETGLLYRMLPTNTFAFKGETCSIGKLCKDRITLALGT
NVDGSEKLPLLIIGKNRAPHCFKGVKSLPVYYEANRTARMTAVIFEQWMQKLDEKFQAQKRRVVIFVDSLPAHPEVKNLKSIELAFFPSCLSSGFAAMNQGVIKSLKIKY
RHCLIKKFLSSVESSKEFTFSLLDAVDTLHLCWRAIAPETIVKCYEEAGFSSPRGETDTANAEEDAAALDLTAHAVGAGVEFLEGLSIEGYAALDEDLETCEDAPKDGAE
WDEESKQDVTGFYTSDEEEEDSGALEVDLPLPSTNEALTALGTLKRFLRSHDMNDELHSSLADLENFINTLSPK*
76 >lcl|XP_227459.1|Plus117445244..17445624 NW_047626 histone cluster 1, H2bj-like Hist2h2be __SEG__ Chr2 {Rattus norvegicus} MPELAKSAPAPKKGSKKAVTKGQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIANEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSAK*
77 >lcl|XP_228426.1|Plus13838365..3845261 NW_048034 mortality factor 4 like 2-like RGD1564748 __SEG__ ChrX {Rattus norvegicus} MSSKKKGPYLCDQQFAEGDDFSKLKPSDRRVRKARSVSSPQKSTELRSLQSTLQRRRRARSVKKSHSVEKSYSEEKTCAVEKIPSTEKAYSTKKNPSAEKRRSVAKKHHT
IVKSSSTEKLLLAEKHAYAEKCLTTEKRSSAEKHPPTLKGRMTQKSASAGRHHSESHRSGKTLRFPEKSNIKENHHSSVKHSSLEKDHPEDRGRPIKKRCPTEKSQSTEK
GQLTERSSYAPATERGRPTKRSQPTKKGLSNENRHPAKKGYSAKTPGSAERDHQIERGGATDSGLSTEKDCPSRRRRPAKKSHLEEKVHSQKSSYESRVISAEKDGLAGR
VRRKRSNPSEEGHSVKCSICDSSVPSAGKDRPVRSRSDKSNPGEDRRSVESGISASRGPSAGKDSPAGRGRPNKIRRAEKGHSMEYGSSAPRGPSAGKDRPGGRGHPNKS
GPTEESRSVESDTCASKGPSTTGKERPVRRCRLNKNSLAERLCSIQCGICTPRGPSAGKHCSERRGRPNKRVPAEEDRSLKNISASRRPSGGKDRPARSRSNKSGPTKEG
WSVEGSRSTSGRPSEGKDRSGGRGRPNKSGPEKEGPSVNDSRSTSRGPSAGKDRSARRSSSNKSGPTEESLSDERDICESRGPSTGKERPARKCRLNKNSLAEQWCSIKC
GICALKQFSTRKDHSRERGRSKESGVEVGSHLVKSGVSTPRGPSAGKDLPAGRGRPNKSSPAEEGCSVKSSISASRRPSVGRDRPARSCSNKSGSAEESCSVKCGICTPK
VPSAGKDRPGGRGCPNKNSPKKEDPSVKGGRSTSRGPSAGKDRSGGRGHTNKSGPAEESRSVEGSRSTSRGPSAGKDRSGRRRHTNKSGPAEESRSVEGIRSTSRGPSAG
KDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRSGGRGHTNKSGSAEESHSVEGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSTGKDRPG
RRGYPNKNSPKKEGPSVKGSRSTSRGPSAGKDRPGGRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYP
NKNIPKKEGPSVKCSRNTSRGSSAGKDRPGGRGRSNKSSPTEESRSVEGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGSSVKGSRSTSRGPSAGKDRPGRRSYPNKSSP
KKEGPSVKGSRSTSRGPSAGKDRPGGRSHLNECGPEKKCPSVKDSRSTSRGPSAGKDRPGRRGRSNKSSPTEESRSVEGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGP
SVKGSRSTSRGPSAGKDHPGRRSYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPNKNISKKEGPSVKCS
RSTSRGSSAGKDRPGGRGRSNKSSPTEESRSVEGIRSTSRGPSVGKDRPGRRGYPNKNIPKKEGPSVKCSRSTSRGSSAGKDRPGGRGRSSKSSPTEESRSVEGIRSTSR
GPSVGKDHSGKRGHPSKRGPEEEGPSFKGSRSTSRRPSVGKDRSGGRGHSNKSGPEKGDPSVKGRLSISRGSSVGKDHSGGRGHPNERGPEKEGPSAKGSRSTSRGPSVG
KDRSGGRGHSNKSGPEKEGPSVKGSRSTSRGSSVGKDRRGGRGHSNKSGPEREDPSVKGSHNTSRGPSLGKDRPGGRGHPNKSGPAEKIRSVESSTCASKEPSAGNERPA
RRYHSNKSSLAEGCCSIKSGICVPRGPSAGNDHCGRGRPNKSGSAKKSHSVEHSSNISRGPSAGKDRSTSRSGPSKKNQLAQEGPSKEKESYAKRGPSKRKEHHAGRRPN
SSQHEEEFRSFGRGKSKRGPSAGKDHPTGKGQPPKKSRPEKDSSSAERGNHAERGQSTGKDHPTDRGQPRKKSHPEEVGHSVEKGNEERKPSAGKDPHTKRGRPSKKSHP
AERHLSASMKYCPPKKHRPAENVCVKRVRSPERVHSMERGHIAKRSCLAERQLSAEEGSMAEEGCSVETDLSEERAEEGTVVDNMCSVENGHPSMEKVFLEVKPSSGSMS
RVTEPNNLQSTPEKRIDSDTNQVAQVPHCNLPVTVKIKMGVELRVPDELKSRLVEDWDLINKQKQLFQLPAEKNVDTILAEYVTFVKSQGLADNREYSVDEVVAGIREYF
NRMLGTQLLCQFEKPQYAEIHLAYPDIPMSQVYGAPHLLRLFVKIGTALANSPLNRQSLLLVSSYMHDFLEYLAENSTSLFKVSNYKVASAEYCCKAL*
78 >lcl|XP_234076.5|Plus1complement(5548500..5549675) NW_047760 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1-like Smarce1l __SEG__ Chr6 {Rattus norvegicus} MSKRPSYAPPPTPGPTTQMPSSSGFVGYNPHSHLAYSYKLGGNPATNSRGHRVLWHYNSKASKASKATDSLCEVGQKSLRASKGFQP*PNVVGD*QDYWWHMAKSH**RE
TRIFNRIRSRKDRVQ*IYKVLS*FPESLEYINAKSHAEATIRGRKSTETVKHGERRTLYEHSAY*GSK*L**WRFDEGFSPGPFPEKPPPHQ*DPQ*VWYLMSSQLSQQL
EHRSSSERPSL*WFISGN*KQSFFR*RNGTRKRRGNSWKAQNFF*TMNLKGSVV*RWT*T*RRLQLRSHRMRNRPAKGRRRRTRRQQVANKAEEKDENIPDGDDREDTP*
GREPAEW*RRQVYS*GQGEWPGGG*QHVDGREPMIQLTAQRATVRQYGSRPQTQCQKTRRRS
79 >lcl|XP_342522.1|Plus1complement(9061815..9063626) NW_047658 centromere protein B Cenpb __SEG__ Chr3 {Rattus norvegicus} MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEE
LGMDDFTASNGWLDRFRRRHGVVACSGVTRSRARSSAPRAPAAPAGPATVPSEGSGGSTPSWRTREEQPPSVAEGYASQDVFSATETSLWYDFLSDQASGLWGGDGPARQ
ATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQGGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLERGVV
QQVKGHYRQAMLLKAMAALEGQDPSGLQLGLVEALHFVAAAWQAVEPSDIATCFREAGFGGGLNATITTSFKSEGEEEEEEEEEEEEEEEEGEGEEEEEEEEEGEEEEGG
EGEEVGEEEEEVEEEGEVDDSDEEEEEESSSEGLEAEDWAQGVVEASGGFGGYSVQEEAQCPTLHFLEGGEDSDSDSDEEEEDEEEDEEDEEDEDDDEDGDEVPVPSFGE
AMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS*
80 >lcl|XP_344600.3|Plus1complement(3684452..3684844) NW_047492 histone cluster 1, H2ao Hist1h2ao __SEG__ Chr17 {Rattus norvegicus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
81 >lcl|XP_345256.3|Plus117473061..17473453 NW_047626 histone cluster 2, H2aa3 Hist2h2aa3 __SEG__ Chr2 {Rattus norvegicus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
82 >lcl|XP_345892.2|Plus1complement(768623..768907) NW_047797 mCG2299-like RGD1564127 __SEG__ Chr8 {Rattus norvegicus} MFPQSRHPTPHQAAGQPFKFTIRESLDRIKEEFQFLQTQYHSLNLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQPMNVLEGASALVVLKA*
83 >lcl|XP_346042.2|Plus1complement(5501542..5501952) NW_047814 histone H3.3B-like RGD1564447 __SEG__ Chr9 {Rattus norvegicus} MPHTKQSVRKSTGGKAPRKQLATKAAPKSALSTGGVKKPHRYRPGTGALGETRCYQKFTELLICELPFQRLVREIAQDFKTDLRFQSAATDVLQEASEAYLVGHSEDTNL
CVIHAKHVTIMSKDIQLAHHIRGEHA*
84 >lcl|XP_573272.3|Plus11671700..1672332 NW_047356 high mobility group protein B2-like RGD1564519 __SEG__ Chr11 {Rattus norvegicus} MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHR
PKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRPTGSKKKNEPEDEEEEEEEEDDEDEEEEDEDEE*
85 >lcl|XP_573625.1|Plus11786664..1787293 NW_047428 high mobility group protein B2-like RGD1561694 __SEG__ Chr14 {Rattus norvegicus} MGKGDPNKPRGKMSLYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGNKKGKKKDPNAPKRPPSAFFLFCSEHR
PKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRPTGSKKKNEPEDEEEEEEEDGEDEEEEDEDEE*
86 >lcl|XP_574997.2|Plus1complement(17444535..17444924) NW_047626 histone cluster 2, H2ac Hist2h2ac __SEG__ Chr2 {Rattus norvegicus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHKAKSK*
87 >lcl|XP_575600.1|Plus1complement(15960054..15960632) NW_047694 H1 histone family, member X H1fx __SEG__ Chr4 {Rattus norvegicus} MSVELEEALPPTSADGTARKTAKASGSAAPTQPKRRKNRKKNQPGKYSQLVVETIRKLGERGGSSLARIYAEARKVAWFDQQNGRTYLKYSIRALVQNDTLLQVKGTGAN
GSFKLNRKKLEGSAEKRGASAASSPAPKARTAAAAAADRTPARPQPERRAQKSKKAAAAAASTKKVKKAAKPSVPKVPKGRK*
88 >lcl|XP_575704.1|Plus1complement(26919148..26919459) NW_047696 histone H4 variant H4-v.1 RGD1562378 __SEG__ Chr4 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
89 >lcl|XP_576283.1|Plus1545986..546396 NW_047780 histone H3.3B-like RGD1564548 __SEG__ Chr7 {Rattus norvegicus} MARTKQTARKSTSDTAPRKQLATKASCKSAPSTGGVKKPHRYRPGTVALREIRCYQKSTELLIRKLPFQRLVREMAQDFKTDLRFQSAAIGALQEASEACLVGLFEDTNL
CAVHTKHVTIRSKNIQLARRIRGERV*
90 >lcl|XP_576595.1|Plus1complement(21839881..21841335) NW_047816 histone deacetylase 1 Hdac1l __SEG__ Chr9 {Rattus norvegicus} MAQTQGTERKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFC
QLSTGGSVASAVKLNKQQTDIAVNWAGGLHYAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGK
GKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGDGYTIHNVARCWTYETAVALDTEIPNEL
PYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHTPGVQMQAIPEDAIPEESGDEDEEDPDKPISICSSDKCIACEEEFPDSDEEGEGGRENSSNFK
KAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKMA*
91 >lcl|XP_577573.1|Plus1complement(1849278..1849670) NW_047492 similar to Histone H2A.l (H2A/l) LOC502125 __SEG__ Chr17 {Rattus norvegicus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
92 >lcl|XP_577577.1|Plus13729582..3729974 NW_047492 histone cluster 1, H2ae-like Hist1h2ai __SEG__ Chr17 {Rattus norvegicus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
93 >lcl|XP_578415.2|Plus1complement(26956162..26956473) NW_047696 histone H4 replacement-like RGD1565073 __SEG__ Chr4 {Rattus norvegicus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*