SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom B    

ID / Description / Sequence
1 >lcl|XP_001362184.1|Plus11485405..1485785 NW_001581876 histone H2B type 2-E-like LOC100011182 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
2 >lcl|XP_001362266.1|Plus1complement(1487870..1488280) NW_001581876 histone H3.2-like LOC100011304 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
3 >lcl|XP_001362357.1|Plus1complement(1480567..1480959) NW_001581876 histone H2A type 1-D-like LOC100011344 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGSYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKSKGK*
4 >lcl|XP_001362434.1|Plus1complement(1505672..1506064) NW_001581876 histone H2A type 1-D-like LOC100011383 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTKGK*
5 >lcl|XP_001362517.1|Plus11506418..1506798 NW_001581876 histone H2B type 2-E-like LOC100011425 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
6 >lcl|XP_001362695.1|Plus1complement(1531621..1532001) NW_001581876 histone H2B type 2-E-like LOC100011522 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
7 >lcl|XP_001362777.1|Plus11532355..1532747 NW_001581876 histone H2A type 1-D-like LOC100011560 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTKGK*
8 >lcl|XP_001362863.1|Plus11537606..1537917 NW_001581876 histone H4-like LOC100011600 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
9 >lcl|XP_001362954.1|Plus11599404..1599796 NW_001581876 histone H2A type 1-F-like LOC100011675 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKPKGK*
10 >lcl|XP_001363036.1|Plus11629418..1629828 NW_001581876 histone H3.2-like LOC100011751 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLVRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
11 >lcl|XP_001363125.1|Plus1complement(1682030..1682410) NW_001581876 histone H2B type 1-L-like LOC100011929 __SEG__ Chr2 {Monodelphis domestica} MPELSKSAPAPKKGSKKAVTKAQKKDGKRRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
12 >lcl|XP_001363204.1|Plus11682746..1683138 NW_001581876 histone H2A type 1-like LOC100011978 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTKSK*
13 >lcl|XP_001363291.1|Plus1complement(1699856..1700167) NW_001581876 histone H4-like LOC100012021 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
14 >lcl|XP_001363456.1|Plus11753039..1753419 NW_001581876 histone H2B type 2-E-like LOC100012106 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRNRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
15 >lcl|XP_001363478.1|Plus1complement(24538535..24539812) NW_001581969 histone-binding protein RBBP4-like LOC100013256 __SEG__ Chr5 {Monodelphis domestica} MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGS
VSGKIEIEIKINHEGEENRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLHLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAK
TIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNE
TILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS*
16 >lcl|XP_001363527.1|Plus1complement(1748496..1748888) NW_001581876 histone H2A type 1-like LOC100012153 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTKGK*
17 >lcl|XP_001364265.1|Plus12705060..2705371 NW_001581881 histone H4-like LOC100013294 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
18 >lcl|XP_001364340.1|Plus12716427..2716738 NW_001581881 histone H4-like LOC100013336 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
19 >lcl|XP_001364342.1|Plus1complement(1236051..1236320) NW_001581894 barrier-to-autointegration factor-like LOC100014813 __SEG__ Chr3 {Monodelphis domestica} MTTSQKHRDFVGEPMGDKPVRCLAGIGEVLGQKLECRGFDKAYMVLGQFLVLKKDEDLFREWLNDICGANAKQSQDCFECLREWCDAFL*
20 >lcl|XP_001364421.1|Plus1complement(2739122..2739433) NW_001581881 histone H4-like LOC100013379 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
21 >lcl|XP_001364497.1|Plus12855187..2855498 NW_001581881 histone H4-like LOC100013421 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
22 >lcl|XP_001364570.1|Plus12863507..2863818 NW_001581881 histone H4-like LOC100013472 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
23 >lcl|XP_001364631.1|Plus12928426..2928737 NW_001581881 histone H4-like LOC100013511 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
24 >lcl|XP_001364771.1|Plus12958777..2959157 NW_001581881 histone H2B type 2-E-like LOC100013589 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
25 >lcl|XP_001364839.1|Plus1complement(2956108..2956518) NW_001581881 histone H3.2-like LOC100013629 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
26 >lcl|XP_001364911.1|Plus1complement(2958014..2958406) NW_001581881 histone H2A type 2-A-like LOC100013669 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTKGK*
27 >lcl|XP_001364981.1|Plus1complement(2977705..2978085) NW_001581881 histone H2B type 2-E-like LOC100013748 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
28 >lcl|XP_001365131.1|Plus1complement(2999528..2999908) NW_001581881 histone H2B type 2-E-like LOC100013827 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
29 >lcl|XP_001365197.1|Plus13000237..3000626 NW_001581881 histone H2A type 2-C-like LOC100013870 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHKPKGK*
30 >lcl|XP_001365257.1|Plus1complement(3000840..3001232) NW_001581881 histone H2A type 2-B-like LOC100013915 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTESHKPGKSK*
31 >lcl|XP_001365326.1|Plus13001569..3001949 NW_001581881 histone H2B type 1-F/J/L-like LOC100013959 __SEG__ Chr2 {Monodelphis domestica} MPEPGKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
32 >lcl|XP_001365942.1|Plus14408740..4410059 NW_001581995 mortality factor 4-like protein 1-like LOC100011831 __SEG__ Chr7 {Monodelphis domestica} MPPKVAHKIQPRPGSQSQRDLTQVGSSEIQPQPQPQAQPQAHDPEVPTLPSAPGVQALSQPKVGGIPELEPQPETSSEMEPQAGPSSKAPQLEEVPHFEEVPQFEEEEEE
PRPEAEAVTAQILSELEAEAGTPKPPFQVGDQVLCLHGSLLYEAKCLRVAEAACGTEAEAEAGPLTYLIHYTGWNKNWDEWVSACRVFQYSDANLARQSELLVAHQARLP
PRKKRRGALRARKTPGLPGDRVALPAPRRKRSRGGQPSAQAQEAATFREEVRVEIPELLKPWLVGFFWDLVTKQNQLFYLPAAKTVESILEDYAQAKAAPGVPEETAFAV
VEVVAGIKEYFNVMLGTQLLYKFERPQYAQVLAEHPGVCMSQIYGAPHLLRLFVRIGAMLAYTPLDDQSLALLLGHLHDFVAYLAENCAALFSASDYGAAPPEYHDRVG*
33 >lcl|XP_001366052.2|Plus11595920..1596330 NW_001581876 histone H3.2-like LOC100011902 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
34 >lcl|XP_001366116.2|Plus11625598..1626008 NW_001581876 histone H3.2-like LOC100011952 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
35 >lcl|XP_001366286.1|Plus15967058..5967423 NW_001581896 histone H2B subacrosomal variant-like LOC100012084 __SEG__ Chr3 {Monodelphis domestica} MTKAVRSNESQKLTTNQEKKKKKKKKLLLSRNYSLYTHRVLKEVIPNQGLTYKTTEIMNSMINNILERIAEEAGNLLCYKRHLTLGHQDIQMAVYRLLPDELAKHAVAFG
TRAVTTYNDSK*
36 >lcl|XP_001366344.2|Plus1complement(1747201..1747611) NW_001581876 histone H3.2-like LOC100012131 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
37 >lcl|XP_001366966.1|Plus1complement(47651136..47651516) NW_001581982 histone H2A.J-like LOC100017398 __SEG__ Chr6 {Monodelphis domestica} MSGRGKSGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTQSFKK*
38 >lcl|XP_001367318.1|Plus1complement(670453..672030) NW_001581963 jerky protein homolog-like JRKL __SEG__ Chr4 {Monodelphis domestica} MSGKRKRVVLTIKDKLDIIKKLEEGSSSKQLSVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPVSGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRGEKLNGDENVVDAFCSHFREFFKRENLHPEQIYNADETGLFWKCLPTRTSAAKGKFTASGRKLIEERVTVMCCANATGL
HKLKLCVVGKAKKPRSFKGTDTSNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFVKYLPPNVASLIQPMDQGV
IAIMKRHYRAGLLQNNLEEGNDLKMFWKKLTLLDALYEISMAWNMVKPVTITRAWNKIFPGNEEKESLDFDEEEISAAALATILQHTQGCEKMDTDNIERWFEVDSTEPG
YKVLTDSEIIRRAQGQTDESSENEEEEIELIPEKNINHAAALKWTENLLDYLEQQGDMILPDKLVIRKLRATIRNKQKMTMNPTQ*
39 >lcl|XP_001367337.1|Plus1complement(8420810..8421121) NW_001581876 histone H4-like LOC100018602 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
40 >lcl|XP_001367380.1|Plus1complement(8428828..8429139) NW_001581876 histone H4-like LOC100018638 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
41 >lcl|XP_001367431.1|Plus1complement(8447983..8448294) NW_001581876 histone H4-like LOC100018674 __SEG__ Chr2 {Monodelphis domestica} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
42 >lcl|XP_001367521.1|Plus18457143..8457523 NW_001581876 histone H2B type 2-E-like LOC100018739 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
43 >lcl|XP_001367564.1|Plus1complement(8453989..8454399) NW_001581876 histone H3.2-like LOC100018777 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
44 >lcl|XP_001367652.1|Plus1complement(8481401..8481781) NW_001581876 histone H2B type 2-E-like LOC100018877 __SEG__ Chr2 {Monodelphis domestica} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
45 >lcl|XP_001367690.1|Plus1complement(28008666..28009949) NW_001581837 histone-binding protein RBBP4-like LOC100018407 __SEG__ Chr1 {Monodelphis domestica} MADKEAALDDAVEEQVSNEKYKIWKKNTPFLYDLVMTHALECPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDVQNHLVIASVQLPNDDAQFDASPYDSEKGEFGGFGS
VSGKIKIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGKCNPDLRLGGHQKEGYGLSWNPNLSGYLLSASDNHTICLWDISAVPKEGKVVDAK
TIFTRHTEVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHLVDAHTAEVNCISFNPYNEFILATGSADKTVALWDLRNLKLKLHSFESHKDEILEVQWSPHNE
TILASSGTDPRLNIWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIHNDEDPEGSVDPDPEGQGS*
46 >lcl|XP_001367696.1|Plus18484664..8485074 NW_001581876 histone H3.2-like LOC100018908 __SEG__ Chr2 {Monodelphis domestica} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
47 >lcl|XP_001367736.1|Plus18482120..8482512 NW_001581876 histone H2A type 1-F-like LOC100018942 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKPKGK*
48 >lcl|XP_001369936.1|Plus1complement(67915889..67916158) NW_001581837 barrier-to-autointegration factor-like LOC100025920 __SEG__ Chr1 {Monodelphis domestica} MATSQKHRDFVAEPMGDKPVGCLAGIGEVLGKKLEDEGFDKAYVVLGQFLVLKKNEDLFREWLRKTFGANARQSRDCFVCLQEWCNAFL*
49 >lcl|XP_001369957.1|Plus17942052..7942996 NW_001581959 WD repeat-containing protein 82-like LOC100015998 __SEG__ Chr4 {Monodelphis domestica} MKLTDESLRSFRVAKVFQENSDKINCFDFSPNGQAIISSSDDDSIVLYDCGEGRPKRTLYSKKYGVDLVRYTHAIDTALCSSNKIDDTIRYLSLKYNKYIRYFPGHDKKV
VALSMSPADETFISASLDKTIRLWDLRVPNCQGLMYLQGKPVCAFDPEGIIFAAGVNSEIVKLYDLRAFDKGPFANFEIQQDKTCEWTGLKFSNDGKRILISTNGSFIHL
IDSFRGVVIHSFRGYNNSKAVALESSFTPDSQFIMTGSDNGKIHVWNGESGVKVAVLNGKHTGPITCLQFNPKFMTFASTCSNMVFWLPTIDDS*
50 >lcl|XP_001370540.1|Plus1119475636..119476073 NW_001581961 histone H2A.x LOC100024720 __SEG__ Chr4 {Monodelphis domestica} MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKSGAITGPKAPGSGGSKKSTQASQEY*
51 >lcl|XP_001370558.2|Plus1232490..236521 NW_001587042 hypothetical protein LOC100016800 LOC100016800 __SEG__ ChrX {Monodelphis domestica} MVEGPRSSDGTSGSSMEEGPSTSPGSGGSSSMTEGPGSSGGTGSSGMEEGPSTSPGSGSSEGTNASPDSGGSSMTEGPRSSGGTSGSSMEEGPSASPGSGMAEGPSASPS
SGGSSMVEGPSASPNSGGGNMAEGTRSSSGTGGSGMEEGPSASPGSGDSSMAEGPRSNGDTGGSSMAEGPSARPSSGGSSMAEDPRSSGGTGGSSMAEGPSASPGSGGSS
MVEGPRSNGGSGSCSSVEEGPNTGGRGNNSSSMAEELRSSGGSSMAKGLRSNSGTGGSGGEDPSTKNSSSSDEDSSSSGSTSGGRGSDGGEGDGDGEGDSDEGDGEGDSG
GDEGDGDDGDGDGDGDDGDGEADSGSDEGDGDDGDGDGDGDGDGDGDSGGDEGDGDEGDDEGDSDGGEGDSNCNKDSDGSLRGICSGPSPSPRGTVKGTDGNLCHSGTGA
GCHRPDFSGTFRFSDMGFSSASEDEDEDDDSDTDYNDMDNNNDDKDGNRSPSGATGTGGRAGLIASSRLSNISFSSSRNGASSTPRSFPGFTSIGGTSASGAGPSVGISS
SDSFQAISNIFQSISSSLPTTNVFPNITGIFHDTSSRSTSPSPGTSGNIFQRTSGDGSSTSNLFASTSGNGSRIGGLFATSGDGASTSNLFSATSGEGFRTSSLFSATSG
EGFRTGSLFSAPSGEGFRTGSLFSTTSGHDTRTGSLFSATSGEGFRTGSLFSTTSGDDTRTGSLFSATSGEGFRTGSLFSATSGHDTRTGSLFSAPSGHDTRTGSLFSAP
SGEGFRTGSLFSAPSGDDARTGSLFSSPSGDDARTGSLFSAPSGDDARTGSLFSSPSGDDARTGSLFSAPSGDDARTGSLFSAPSGDDARTGSLFSAPSGDDARTGSLFS
APSGDDARTGSLFSSPSGDDARTGSLFSAPSGDDARTGSLFSAPSGDDARTGSLFSAPSGDDARTGSLFSAPSGDDARTGSLFSAPSGDDARTGSLFSAPSGDDARTGSL
FSAPSGDDARTGSLFSAPSDGSGTSDLFSCTSGLGLRTGSGLSSTSQVSTKPLEASSGRSSSNVLISQGGGEASTTTGFEVAFERQFCHVVSGWNYEWTPEGQVLSYAAT
TLQQESDVGLKRTSKRKQEDEDQAATSSGSDQNESSASGAGMMQPPSKKSRVSVAAEREYLLWGSLGKEFRGREEVPVHIPEALKPLLVQDWELVTLGKKLFNLPAKKTV
SVILSEYATFQPNCQSRDKRCSVSALVAMIKEYFDFLLATRLLYKFEKQQHAEILARFPTHKMSQIYGGPHLLRLFQQLGPMLTYTSLDDNSLNVLMTHLQDFLEYLARN
PSQLFTAATDYHLATKEYQEKAE*
52 >lcl|XP_001370887.2|Plus1383312..384868 NW_001587042 mortality factor 4-like protein 1-like LOC100017278 __SEG__ ChrX {Monodelphis domestica} MADSRFEGDREEEFRGLPTIQEGEPVLTFRGPKMRRGECVLVDSEDRKVRYLIRYQRAGLGPMGEERVAFGEVPEPAEEGAQEMEIESEGETGPGLEGGPEKEGGAGAKE
REDEPPPEAEEEAEVEPMIEAVPSNLEAGASRSPSPKRRRRSSPSPSQRRSPSRSRSSTSSTLSLLEDDDDDDDDDDDDNGEEGEDFEEPMMPSEEEFSTESSNLGAGYG
GASGPVTSRQSGTPRFQLSREQLCSIVVIGGWEYEWVPENRLLRYSAVQVQLDSDAALQMAAKREQQEDCPVSSTGGSTSLAATVTGPPAFGPPPSKRGRRGRGWGRGRL
RSLRRRSQGGRGAGGDSRRVVHVNLPKALKPLLVQDWELVIFGKKLFTLPARKTVDAILTEYASFQESLATPARKNAVNELMAMIKEYFDMVLGTQLLYNFERPQYTEIL
VSQPTAQMSQIYGGAHLLRLFPQMASLLSLSLLGENSLGVLLTHLQDFLEYLATNPSLLFIDPTDYQVATEEYQQLAG*
53 >lcl|XP_001371819.1|Plus12128288..2128656 NW_001581873 cornifin-A-like LOC100018715 __SEG__ Chr2 {Monodelphis domestica} MSSHQHKQPNTIPPQLHQQQVKQPSQPPPQEPCNPKGPQPGTTKLPQPNYPKVPQPGTTKLPEPCQPTVPGQHPTKKPEPYYPVVSVPTQSKVPEPGTTKVPGSYPPPAQ
EKYPQVPKTKQK*
54 >lcl|XP_001372430.1|Plus1complement(35739154..35743401) NW_001581968 structural maintenance of chromosomes protein 4 SMC4 __SEG__ Chr5 {Monodelphis domestica} MPPRKKAKRSTAKAVQEPEEEPPSCGAAAVKRPRKKAKRPAAQALPEPVKVPVPVPEEPPQLEREVAQQSPQWLEEPQLSPQQWQTEAELSPPQLQAVSELSPPQWQPGV
ELSPPQLQPEAELPSLQRQSEAELSPTPWQPEAELSPPQLQPEAAEASPPWLQPELGPGASPRSSQSESEDRLTLEEILAAVPPPPPRGMINKEGTPRLMISHIVNLNFK
SYAGRTQLGPFHKHFSCIIGPNGSGKSNVIDSMLFVFGCRAHKIRSKKLSVLIHHSDDYQDLDSCTVEVHFQKIIDKEGDDYEVIPNSSFYVSRTAYKNNTSVYHISGKK
QTFRDVGNLLRSHGIDLDHNRFLILQGEVEQIALMKPKGQSEHDEGMLEYLEDIIGCGRLKEPIEVLSQRLDVLTEEREEKLNRVKIVEKERNYLEIEKNLAIDFLTIEN
EILTKKNHICQFYIYDLHKRIAEVEYEKDKILEETEAIKKKTSKLEGEMNAKTNALEEAERKLNQVATFIEENKEKYTQLDLEGVQVKTKMKYAKTKARKLEKQLQKDKE
KVEEFKDVPAKSEKVITETTTKKSTLEEEREKEEEKMKQVMDSLKQETKELQEEKESQEKELMEFNKTVNEARSKMDVAQSELDIYLSHHNTAVSQLSEAQKALTTASET
LKERKTAIRDIEMKLPPTEQDLKEKESELQNLTKEARDLDSSIRDLLQKVEEAKSSLATNQSRGKVLNALIQQKLSGKIQGIYGRLGDLGAIDEKYNIAISSCCSALDYI
VVNTIDTAQVCVNFLKKQNIGVATFIGLDKIKVLEKNMNPLQTPENIPRLFDLVKAKDENIRRAFYFALRDTLVADNLDQATRVAFQKDKRWRVVTLQGQIIEQSGTMTG
GGSKPMKGRMGSSLVMEVSEEEVANMESILRRDSQRAIEVQERKAQLEEAMIKLRHSVQDMRNTLEKFTVSIQSLSEQEAYLNAQVKELKANVCDTVPDKNKQKFLETQI
NTFKKEYECVALKAGKVEAEVKRLHNLIMEINNHKLKSQQDKLDKINKQLDQCASSITKAQVGVRTANRNLKKAQDSVLRTEKEITDNDKEMEDFTQELEDLEEKATEIM
KNSKEAGESLPEIQREHNNLVKEMKVIKENECSLQNDALSNKLKLEQVDSYIAEQHSKVRFWEKEMSRIALHPIENNQAEQISLLSQEDLEEIGNPNFLNNQIELLESQC
NAMNPNLDSIEEYKKKNQQYLHRVAELEKITIERDRYRRAYKDLRERRLNEFMAGFTIITNKLKENYQMLTLGGDAELELIDSLDPFSEGIMFSVRPPQKSWKKIFNLSG
GEKTLSSLALVFALHDYKPTPLYFMDEIDAALDFKNVFIVAYYIYKQKKDAQFIIISLRNNMFEIADRLIGIYKTNNVTKSVTINPKAIAAKGVC*
55 >lcl|XP_001372534.2|Plus1complement(8456412..8456804) NW_001581876 histone H2A type 1-F-like LOC100019804 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKPKGK*
56 >lcl|XP_001374118.1|Plus134182..35366 NW_001587030 mortality factor 4-like protein 1-like LOC100022185 __SEG__ ChrX {Monodelphis domestica} MAPAKSRKVQDRPNVREEEPVLTFHEGRIRKGQCIRGDVQDRQVKYLVRYPTGSNGVPLRMSLSYPFDLPGWSPPAPRPGAWTSRLSSNKGGSWAMSSLGEEEVVPSTST
STSTIGMFSRGPDCPVAPEWEYEWVPEARVLRYITTHRQKDSDSALQKAAKELVQGKLPSASSKVQGDRGEGCPSGAPEGQQLPRKHKQKGEPWSGRGRWGGARAAHEHR
CLGKLEVQICLPKALRPLLVQDWKLVTMEKQLFILPARKPVEAILAEYVVCQENCLTAFRKYSVGEVVVALQEFFDLVLSSQLLFRFEKLQHCQIVLRHPGARMSQIYGG
AHLLRLFLQLGPMLACAPLGTTSLQVLLGHLQRFLKYFASNPSLLFKAATDYRVASAKYQQQAG*
57 >lcl|XP_001374456.1|Plus1complement(3480827..3481768) NW_001587050 WD repeat-containing protein 82-like LOC100022679 __SEG__ ChrX {Monodelphis domestica} MKLTDGVLRSFRVAKVFRENSDKINSFDFSVSGETAVSSNSDDTITLYDCQEGKPKRTLYSKKYGVDIIKYTRAESTVIYSCNKIDDAIRYLSLPENKYIRYFHGHKKTV
VTLSMSPSDETFISGSIDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMIKLYDLRSFDKGPFATFRMEQDKTYEWTGLKFSKDGKHILLYTNGSCFHV
VDAFKGIVTHIFSGYNNHQALSLEAAFTPDSQFVMIGSEDGKIHIWNGENGEKVAVLDAKHTGPITCLQFNPNFMTFASACSNMSFWLPTIDD*
58 >lcl|XP_001374552.1|Plus116121104..16122546 NW_001581965 something about silencing protein 10-like LOC100022826 __SEG__ Chr5 {Monodelphis domestica} MVGKTRKRTVGQRRPAKTQVEEEEEEQELPPSPGDPSYFQDQVDAFHEARSRAALAPSWSDGESGAEDPEEEEEVLGLDLHEDSEEEEDGEEDEEDEEEDDAASVGGSSV
LSDADPAADADPSLSWGQRKNLYYNTDYRASKGKGLQSQQEADEEEREEEEEAQLIQRRLAQGLQEDDFGLSWVEAFGKSALAPALPEEAQTRVVKDLDKMPSKEKLKML
RKESPELLELIEDLKAKIIEVKDELEPLLHMVEKGIIPPGKGSQYLKTKYNLYLNYCSNISFYLVLKARRVPIHGHPVIERLVTYRNLINKLAIVDQRLSNEMRRLLTQS
STDGKVAANLKKKATKLKPKSLTKIPDLSAVPDLADDSDLDEEASLKHYKEMEERLKLKRKKEEAAVGEEEVLEDPNAKRAITYQIAKNKGLTPRRKKIDRNPRVKHREK
FRRAKIRRRGQVPQVRTEEYKYSGELSGIRAGVKKSIKLK*
59 >lcl|XP_001374617.1|Plus14808183..4809424 NW_001587050 mortality factor 4-like protein 1-like LOC100022919 __SEG__ ChrX {Monodelphis domestica} MAPKKDKRKCPRKPRFQEGDRVLCFHGPFLYKAECMKVSVKYRKVKYQVRYFGVKERNALKLKVVEHLSQVESPDACQPGTSNDKDSAVALPAAGSDAGVAFKKRPVPQA
DWEDEWLPQSKLLKYNQANLRKLRELNRKQAQPATGTVTRSSPREKAPPTQRKTARASTLRIQNAKNNAKKAPPVGVAQTTTSKTGRKRGRPPGSKSKGKTSVAGKRKAP
PNSAVAADSDSDGELNRRFLRNPQSRVRIPEVLKPLLMDDWDLIVKQNQLFRLPAKKTVASILEDYEQSEKAVENADEKWLQDVSEVVSGIKAYFNVMLGSQLLYKFERP
QYAEILATQPGVSMCHIYGAPHLLRLFVKFEEMLTHTPLEEPSLALLLQHLHSFLGYLEKKFSDLFNFNEYEVAAPEYFRKAF*
60 >lcl|XP_001374661.2|Plus1complement(5044047..5046257) NW_001587050 hypothetical protein LOC100022980 LOC100022980 __SEG__ ChrX {Monodelphis domestica} MAPKKDSKKRPKKPQFEVGERVLCYHGSLLYEAECVKVSVKYRKVKYLIHYPGGNEKGVVVRTRLSEKLAKMRAQEAQKAEAANKAPKASEVHEASKGSETLEPGEVSVT
CEVHEAEVHEAKPHEAATQVSDGATEVQAIPQTPIAPTARAARKARRARKARALLAAAEASKPGEAGEVPDMRETRMGRLIREARAREAAREAAKAREEAAREATKAPDK
AIKPAAAEERDKTLMVCEVHAAEAGEATDARESPKDFAEATTAQGEVAKPGATGGTFIVAEAAGETTSAQEVASASDDYNIGEPCKPCEIIEIREIHRTHIICEVQEDGA
SGGPQTIEVCEVVEASDIFKASKRDDIHAATEAVRDTEVHDTSEADRVSETGQTSVSCEMTDTSEATKVSEFSEEQLGAKSKVKKKKRGKSKAKSEVAQFPTEDDFGSKD
VICLTTGWDDEWVPESRLLKYSEANLQKQKELFQAHQEMYAKKEKGGASGKTSESPKKKPVERVETPSVSTQAESGGSRSRDEASTSDQPPRWRRKPLESSEGGGAQQRQ
VRRHDFKINIPQELKPWLVNDWNLITVQKKLFSLPARKNVESILEDYELYEKTYATTEDKIYAVPEIVAGIRAYFNLMLSSHLLYKFEKPQHAAIVASNPTVLVSQVYGA
PHLLRLFVKIGDMLSYAFFDSHSTNLLLRYLHDFVKYLADNSAALFSSDDYELASPEYLLKAAEDAEPTSTAGSSK*
61 >lcl|XP_001377738.1|Plus1complement(78132640..78132894) NW_001581968 barrier-to-autointegration factor-like LOC100027451 __SEG__ Chr5 {Monodelphis domestica} MTTIQKLHDFMAKPMGDKPVQCLADIREMLGKVLEDKGYDKAYVVLGKFFMMKKDKDFFWEWHRVICGANAKQSQCVKWKGIMR*
62 >lcl|XP_001379420.1|Plus1420717..421979 NW_001587037 mortality factor 4-like protein 1-like LOC100029741 __SEG__ ChrX {Monodelphis domestica} MASFEPKGKPGKFLPVVQEGETVLTFQGPKMRLAQCIWVTMEDKQVKYLVRYPPETQIRPAWDGIGTYPIANVWPPLLELSQPAARDPSVWPNSRRGRGRALALASFGRG
GFSQFPSLGRGGIGSNILAPMPVVPQVFTSEPLCPVAPHGWFYEWLPEGNVLRYSIAYLQEDRYAYVLLQMAAERRQQEITRPLIPPAEGNLCPLGENTIFQGAPGGSNF
QRGRARSRGRRGRASREKEASGEAEKESLGRKVQVQLPSTLTPLLMRDWEMVTLQKKLFTLPARKTISVILSEYATFHPEAWSTDKKHAVCGLVAVIKEYFELVLGTQML
YKFERPQYAEILARYPRTQMTQVYGGSHLLRLFTKLGSMVSSTSLDDKNVQMLMGHFGDLLEYLGSNPSLLCITPADYQMTTKEYQEKAE*
63 >lcl|XP_001380078.1|Plus1complement(69041858..69042289) NW_001581982 histone H2A.x-like LOC100030614 __SEG__ Chr6 {Monodelphis domestica} MSEKRSHPGPSHPRSRTRSRSSRAQLQFPVSRVDRFLRQGHYAQRLASGAPVFLAAVLEYLTAEILELAGNAARDNQKSRIAPRHVQLAVRNDAELNQLFGDVTISQGGV
LPRIHSELLQSVNKAQSSRNLGGNSFIQTVKTK*
64 >lcl|XP_001380458.2|Plus19591537..9593303 NW_001581847 major centromere autoantigen B-like LOC100031122 __SEG__ Chr1 {Monodelphis domestica} MGPKRRQLTFREKSHIIQEVEKNPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKFGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVNGIILKEKALRIAEE
LGMEDFTASNGWLDRFRRRHGVMSRNGVTKSRSQPSAPAQPPPPPRAPAPVPAADGGGGGGSRRWREELLPSLAEGYASQDVFNATETSLWYNFLPDQAPALRGEARPSP
RRGTERLIVLLCANADGSEKLPPLVVGKLAKPRGSRAGLPCDYTANPKGGVTAQELAKYLKALDARMADESRRILLLANRPAAPALDTSDLRHVQVAFFPSDTLQPLERG
VVQQVKGHYRQALLLKAMAALEDHDRSRLQLGLTEALRFVAAAWDAVEPADIAACFREAGFGGGPGPDIDEAVKSEEEEEEEEEEEDDNEEEEEEEDQGEEEGEEEGEEG
EEGEEEEEEEESSSEGLEADDWSQGGGEAGGSFVAYGGQDEQGCPTVQLLEAGEDSESESDEEEEEEEDDDDDDDDDDEDDDDDDEVPVPSFGEAMAYFAMVKRYLTSFP
IDDRVQSHILHLEHDLVHVTRKNHARQTSRALAHQNLA*
65 >lcl|XP_001381773.1|Plus1complement(175890699..175892411) NW_001581902 jerky protein JRK __SEG__ Chr3 {Monodelphis domestica} MASKQPIVKNKGEKRKRVVLTLKEKIDICTRLEKGENRKALMQEYNVGMSTLYDIKAHKGQLLRFFANSDSNKALEHRRTLHTPKLEHLDRVLYEWFLVKRSEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDVSNERQSADHQAAEQFCGFFRSLIAEHGLSPEQFYNADETGLFWRCLPNSTPEGASASSLKQTKDRLTVLM
CANAAGSHKIKPLVIGKCNGPRTFKGIQHLPVAYKAQGNAWMDKEIFSDWFHHIFVPSVKDHFRNIGLPDDSKAILLLDNSRAHPQEAELVSDNIFTIFLPASVTSLIQP
MDQGIRRDFMRNFINPPVTVQDLQTRYNISDAIFNVACAWNSVTSEILRRAWRKLWPSVMFAEVSSDEEEFDRFRVRPPNNTLVQILEMVKDPPSPPVNKLNKNEGNKWA
DADQEGEVSQGVSDTEIVETVWNPDNGTDSEKDSDGEDFREGEKTSWEKAASSFDSIISFAEKQPCFTNQEIMQLHMLHAIFMRQRQMANKQTEIRDIVKTENPRGYPGV
CTDSAQSPIPSTSTALYSDN*
66 >lcl|XP_003339582.1|Plus1complement(51106063..51107634) NW_001581837 tigger transposable element-derived protein 6-like LOC100619610 __SEG__ Chr1 {Monodelphis domestica} MANKGNKKRRQFSLEEKMKVVEAVDSGKRKGDVAKEFGITPSTLSTFLKDRAKFEEKVREASVGPQRKRMRNALYDDIDKAVFAWFQEVHAKNILVSGSVIRKKALNLAN
MLGYDNFQASVGWLNRFRDRHGIALKAICREDNDKLMNGIGIDKVNEWHAGEIIKLIADYSPDDIFNADETGMFFQLLPQHTLTAKGDCCRGGKKARQRLTALFCCNASG
TEKMKPLIVGKSATPRCFKNVHSLPCDYRANQRAWMTRDLFNEWLMKVDAKMKQAERRILMLIDNCSAHNMLPRLERIQVGYLPSNCTAVLQPLNLGVIQTMKVLYRSRL
LKQIVLNLNNNEEKEKINIKQAIDMIAGAWWSVKQSTVVKCWQKAGIIPMEFTDTEPEDDDEPDIAIEKLWNSVAIATCVPNEITFQDFVTADNDLLISCELTDVEIVES
MMTGTRPEESESEDDEGVSFLEQPKLTIAEAISSVEKLRQFLSTCTDVPEAVFGQLNGIDEYLMTSVTHTLVESKITDFLQAK*
67 >lcl|XP_003340544.1|Plus12978456..2978848 NW_001581881 histone H2A type 2-A-like LOC100617936 __SEG__ Chr2 {Monodelphis domestica} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTKGK*
68 >lcl|XP_003340764.1|Plus1complement(8636542..8638557) NW_001581903 tigger transposable element-derived protein 5-like LOC100619342 __SEG__ Chr3 {Monodelphis domestica} MYPSGPPGPAPHPRRRRPLAPSRPGPPLLPQAVGEEEPPPQASGRGPLPAVPAAPPGSGGSPGAPGLAVKMAFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLR
GWLKDEPKLRWFLDQLGGEVGTQRKKMRLANEEEIDRAVYTWFLTLRQHGIPLSGPIIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPPPPPPAS
APSLPTVKTEPDLVGMGDHPSPMQPPTPTDGGYGDEQIYNANVTGLYWKLLPEQAAPPGEGDPGSGGRRWRGDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDK
FPASYRYSPDAWLSATLLRGWFFEEFVPGVRRYLRRSCLQQKAVLLVNHHPGPRPQGPRPPSPEESEEAGEQPRAAGGLGPGPALCHPEELQTPDGAVRVLFLSKSSARG
KIPAPLEQGVVSAFKQLYKRELLRLAVSCAGGSPLDFVRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPDDEEQLVQPHPGASGEDEEAEEHSKVLSDLTH
LAALTYKRLAPEDVAEWLHLDDGAPGLGEPPEGGGEEDEDGGGREYPPCGGFPPLAGPPQGEEDSGTGGSSPVPTAGEAIKGLETALRWLESRDPREVGPLKLVQLRSLI
SMAQRLGETGP*
69 >lcl|XP_003341417.1|Plus1complement(20940123..20941709) NW_001581965 tigger transposable element-derived protein 2-like LOC100618011 __SEG__ Chr5 {Monodelphis domestica} MSGKRKRVVLTIKDKLDIIKKLEEGSSFKRLSVVYGIGESTVRDIKKNKERIITYANSSDPTSGVSKRKSMKSSTYEELDRVMIEWFNQQRNEGIPVSGTICAKQAKFFF
DALGMEGDFNASSGWLTRFKQRHGIPKVAGQGTKLNGDETAASEFCCKFREFVEKENLQPEQIYSADQTGLFWKCLPSRTLAFETEHSTSGYRSSRERIIVMCCANATGL
HKLNLCVVGKAKKPRSFKGTEPSNLPVSYFSQKGAWIEHPVFRQWFVKNFVPQVRKNLKSKGLLEKAVLLLDFPPAHPDEEILSSDDGKIFVKYLPANVTALIQPMCQGI
LATVKRYYRAGLLQKYMDEGIDLKMFWKNLTVLDAIYEVSRAWNMIKSVTITRAWNKLFPGIEENIGLNFDEGAILAANLATVLQHTEGCENVDIENIEDWFEAENTEPN
YDVLTDSEGTQGQIDQSDHSSENEEVEETELISQRHISHKSALEWTENLLDYLEQQDDMLLSDKLVLRRLRTTIRKKQKTQNNNKSQQ*
70 >lcl|XP_003341803.1|Plus169024072..69024503 NW_001581982 histone H2A.x-like LOC100618884 __SEG__ Chr6 {Monodelphis domestica} MPEKRSHHGSLNTHNQIRSRSSRAQLQFPVSRVDRFLRQGHYAQRLASSAPVFLAAVLEYLTAEILELAGNAARDNKKTRIAPCHVQLAVRNDVELNQLFGHVTISQGGV
LPRIHPELVQPATGGRSSQSHVGRNHNYSVKAK*
71 >lcl|XP_003341842.1|Plus1complement(6383947..6384357) NW_001581988 histone H3.3-like LOC100014048 __SEG__ Chr7 {Monodelphis domestica} MAPTKQTALKSTGGKEPRKQLSTKAAHKSSPSTGGVKKPHRYRLGTVALREIRRYQKSTKLLIRKLPFQRLVHEIAQDFKTDLRFQSVAIGALQEASEAYLVDLFEDTNL
CAIHTKHVTIMPKEIQLAHCICGERA*
72 >lcl|XP_003341883.1|Plus1complement(7739807..7740946) NW_001581992 histone deacetylase 8-like LOC100618462 __SEG__ Chr7 {Monodelphis domestica} MQEAEEPSPPPRQPPLPPVYIYSPEYVRTCDSLAKVPKRASMVHSLIEAYELLKEMRVVKPKVASMEEMASFHTDAYLQHLQKVSEEGDDEHPDSVEFGLGYDCPSTEGI
FDYAAAVGGGTITAAQCLIDGTCNIAINWAGGWHHAKKDEASGFCYLNDAVLGILHLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVG
LGKGRYYSVNVPIQDGIRDEKYYQICRSVLKEVYAAFNPKAVVLQLGADTIAGDPMCSFNMTPVGLGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGRTLS
SEIPDHEFFTSYGPDYVLEITPSCRPDRNELHQIQHILNRITGNLKHVV*