SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau B    

ID / Description / Sequence
1 >lcl|NP_001032546.1|Plus1complement(2089774..2090154) NW_001494731 histone H2B type 1 H2B __SEG__ Chr3 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
2 >lcl|NP_001032546.1|Plus1complement(2089774..2090154) NW_001494731 histone H2B type 1 H2B __SEG__ Chr3 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
3 >lcl|NP_001039711.1|Plus1complement(531774..532154) NW_001494179 histone 1, H2bi HIST1H2BI __SEG__ Chr23 {Bos taurus} MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
4 >lcl|NP_001039711.1|Plus1complement(531774..532154) NW_001494179 histone 1, H2bi HIST1H2BI __SEG__ Chr23 {Bos taurus} MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
5 >lcl|NP_001071346.1|Plus1214977..215555 NW_001495157 nucleosome assembly protein 1-like 5 NAP1L5 __SEG__ Chr6 {Bos taurus} MADSQNQGSAEPSQAAAAAAAADAAAAAEEVMAEGGAQGGDSDSASSDSDGVVGQMAEEPQTPAENAPKPRNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQAL
EKKYNDIYKPLLAKIQELTGEMEGCAWTLEGDEEDDDDDEYEDEEEGEEEDEEEEEPAAEAAGTAAAKDEGPHSAVPDDAKK*
6 >lcl|NP_001071346.1|Plus1214977..215555 NW_001495157 nucleosome assembly protein 1-like 5 NAP1L5 __SEG__ Chr6 {Bos taurus} MADSQNQGSAEPSQAAAAAAAADAAAAAEEVMAEGGAQGGDSDSASSDSDGVVGQMAEEPQTPAENAPKPRNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQAL
EKKYNDIYKPLLAKIQELTGEMEGCAWTLEGDEEDDDDDEYEDEEEGEEEDEEEEEPAAEAAGTAAAKDEGPHSAVPDDAKK*
7 >lcl|NP_001071382.1|Plus12114295..2114993 NW_001493091 inhibitor of growth family, member 1 ING1 __SEG__ Chr12 {Bos taurus} ILKELDEYYERFKREADGAQKRRALHCIQRALIRSQELGDEKIQLVSQMVELVENRARQVDSHVELLEAQQEAADATGHSKAGQDKSKNEAIAQAEKPNNKRSRRQRNNE
NRENAANNHDHDDVTSGTPKEKKAKASKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLSHKPKGKWYCPKCRGESEKTMDKA
LEKSKRERAYNR*
8 >lcl|NP_001071382.1|Plus12114295..2114993 NW_001493091 inhibitor of growth family, member 1 ING1 __SEG__ Chr12 {Bos taurus} ILKELDEYYERFKREADGAQKRRALHCIQRALIRSQELGDEKIQLVSQMVELVENRARQVDSHVELLEAQQEAADATGHSKAGQDKSKNEAIAQAEKPNNKRSRRQRNNE
NRENAANNHDHDDVTSGTPKEKKAKASKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLSHKPKGKWYCPKCRGESEKTMDKA
LEKSKRERAYNR*
9 >lcl|NP_001071531.1|Plus134781..35161 NW_001494179 histone H2B type 1-K HIST1H2BK __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSAK*
10 >lcl|NP_001071531.1|Plus134781..35161 NW_001494179 histone H2B type 1-K HIST1H2BK __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSAK*
11 >lcl|NP_001071557.1|Plus1complement(428803..429192) NW_001495088 histone H2A.J H2AFJ __SEG__ Chr5 {Bos taurus} MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESQKTKSK*
12 >lcl|NP_001071557.1|Plus1complement(428803..429192) NW_001495088 histone H2A.J H2AFJ __SEG__ Chr5 {Bos taurus} MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESQKTKSK*
13 >lcl|NP_001073248.1|Plus1complement(2887869..2888300) NW_001493293 H2A histone family, member X H2AFX __SEG__ Chr15 {Bos taurus} MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTSATVGPKAPAGGKKATQASQEY*
14 >lcl|NP_001073248.1|Plus1complement(2887869..2888300) NW_001493293 H2A histone family, member X H2AFX __SEG__ Chr15 {Bos taurus} MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTSATVGPKAPAGGKKATQASQEY*
15 >lcl|NP_001075189.1|Plus1complement(2056739..2057128) NW_001494731 histone H2A type 2-C HIST2H2AC __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKFKGHKAKSK*
16 >lcl|NP_001075189.1|Plus1complement(2056739..2057128) NW_001494731 histone H2A type 2-C HIST2H2AC __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKFKGHKAKSK*
17 >lcl|NP_001075211.1|Plus1complement(1124476..1124856) NW_001494173 histone cluster 1, H2bn HIST1H2BN __SEG__ Chr23 {Bos taurus} MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
18 >lcl|NP_001075211.1|Plus1complement(1124476..1124856) NW_001494173 histone cluster 1, H2bn HIST1H2BN __SEG__ Chr23 {Bos taurus} MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
19 >lcl|NP_001091566.1|Plus1925764..926156 NW_001495310 histone cluster 3, H2a HIST3H2A __SEG__ Chr7 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
20 >lcl|NP_001091566.1|Plus1925764..926156 NW_001495310 histone cluster 3, H2a HIST3H2A __SEG__ Chr7 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
21 >lcl|NP_001092190.1|Plus11144324..1144716 NW_001494173 histone cluster 1, H2ag HIST1H2AG __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
22 >lcl|NP_001092190.1|Plus11144324..1144716 NW_001494173 histone cluster 1, H2ag HIST1H2AG __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
23 >lcl|NP_001092554.1|Plus1697724..698587 NW_001508751 mortality factor 4 like 2 MORF4L2 __SEG__ ChrX {Bos taurus} MSSRKQGSQTRGHQSAEEDNFKKPTRSNMQRSKMRGSSGKKTAGPQQKNLEAALPGRWGGRSAENPPSGSVRKTRRNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVES
EDAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDTILEEYANCKRSQGNVDNKEYAVNEVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQ
VYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNAASLFTASDYKVASAEYHRKAL*
24 >lcl|NP_001092554.1|Plus1697724..698587 NW_001508751 mortality factor 4 like 2 MORF4L2 __SEG__ ChrX {Bos taurus} MSSRKQGSQTRGHQSAEEDNFKKPTRSNMQRSKMRGSSGKKTAGPQQKNLEAALPGRWGGRSAENPPSGSVRKTRRNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVES
EDAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDTILEEYANCKRSQGNVDNKEYAVNEVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQ
VYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNAASLFTASDYKVASAEYHRKAL*
25 >lcl|NP_001092840.1|Plus1complement(753690..754100) NW_001493203 H3 histone, family 3C H3F3C __SEG__ Chr14 {Bos taurus} MARTKQTARKSTGGKAPRKQLVTKAARKSAPSTGGMKKPHRYRPGTVALREIRRHQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTVMPRDIQLARRIRGERA*
26 >lcl|NP_001092840.1|Plus1complement(753690..754100) NW_001493203 H3 histone, family 3C H3F3C __SEG__ Chr14 {Bos taurus} MARTKQTARKSTGGKAPRKQLVTKAARKSAPSTGGMKKPHRYRPGTVALREIRRHQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTVMPRDIQLARRIRGERA*
27 >lcl|NP_001092854.1|Plus12057447..2057827 NW_001494731 histone cluster 2, H2be HIST2H2BE __SEG__ Chr3 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKNGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
28 >lcl|NP_001092854.1|Plus12057447..2057827 NW_001494731 histone cluster 2, H2be HIST2H2BE __SEG__ Chr3 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKNGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
29 >lcl|NP_001093194.1|Plus1complement(551340..551651) NW_001494179 histone H4-like LOC617875 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
30 >lcl|NP_001093194.1|Plus1complement(551340..551651) NW_001494179 histone H4-like LOC617875 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
31 >lcl|NP_001099113.1|Plus1443546..443749 NW_001494179 histone H2B H2B __SEG__ Chr23 {Bos taurus} MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK*
32 >lcl|NP_001099113.1|Plus1443546..443749 NW_001494179 histone H2B H2B __SEG__ Chr23 {Bos taurus} MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK*
33 >lcl|NP_001108326.1|Plus1270064..270444 NW_001494145 histone H2B-like H2B __SEG__ Chr23 {Bos taurus} MPEPAKKVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKPSTITPREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
34 >lcl|NP_001108326.1|Plus1270064..270444 NW_001494145 histone H2B-like H2B __SEG__ Chr23 {Bos taurus} MPEPAKKVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKPSTITPREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
35 >lcl|NP_001139343.1|Plus1431232..431543 NW_001495088 germinal histone H4-like LOC530773 __SEG__ Chr5 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
36 >lcl|NP_001139343.1|Plus1431232..431543 NW_001495088 germinal histone H4-like LOC530773 __SEG__ Chr5 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
37 >lcl|NP_001160041.1|Plus12171318..2171728 NW_001494731 histone H3.2 LOC504599 __SEG__ Chr3 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
38 >lcl|NP_001160041.1|Plus12171318..2171728 NW_001494731 histone H3.2 LOC504599 __SEG__ Chr3 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
39 >lcl|NP_776305.1|Plus1672999..673310 NW_001494179 histone H4 H4 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
40 >lcl|NP_776305.1|Plus1672999..673310 NW_001494179 histone H4 H4 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
41 >lcl|NP_991343.1|Plus1complement(716445..716813) NW_001493921 histone H2B subacrosomal variant LOC404073 __SEG__ Chr20 {Bos taurus} MARNVTKRNKRCRGHQKAIYKKKSHSSSESGLRNYSLYINRVLKEVVPQKGISSRTIDIINTMINDMFERISTEACNLMYYRKRCTLTPEDIEKAVYLLLPEKLAKYAVA
FGKEAVQRYVRS*
42 >lcl|NP_991343.1|Plus1complement(716445..716813) NW_001493921 histone H2B subacrosomal variant LOC404073 __SEG__ Chr20 {Bos taurus} MARNVTKRNKRCRGHQKAIYKKKSHSSSESGLRNYSLYINRVLKEVVPQKGISSRTIDIINTMINDMFERISTEACNLMYYRKRCTLTPEDIEKAVYLLLPEKLAKYAVA
FGKEAVQRYVRS*
43 >lcl|XP_001249525.1|Plus11413076..1413633 NW_001494408 heterochromatin protein 1-beta-like isoform 2 CBX1 __SEG__ Chr27 {Bos taurus} MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP
RGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANAKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*
44 >lcl|XP_001249525.1|Plus11413076..1413633 NW_001494408 heterochromatin protein 1-beta-like isoform 2 CBX1 __SEG__ Chr27 {Bos taurus} MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP
RGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANAKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*
45 >lcl|XP_001249529.1|Plus1complement(994771..995181) NW_001495231 H3 histone, family 3A LOC781224 __SEG__ Chr6 {Bos taurus} MARTKQTARKSTGGKAPRKQLTTKAARKTAPSIGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDYKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
46 >lcl|XP_001249529.1|Plus1complement(994771..995181) NW_001495231 H3 histone, family 3A LOC781224 __SEG__ Chr6 {Bos taurus} MARTKQTARKSTGGKAPRKQLTTKAARKTAPSIGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDYKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
47 >lcl|XP_001249758.1|Plus12096759..2097316 NW_001495460 heterochromatin protein 1-beta-like LOC781578 __SEG__ Chr8 {Bos taurus} MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP
RGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*
48 >lcl|XP_001249758.1|Plus12096759..2097316 NW_001495460 heterochromatin protein 1-beta-like LOC781578 __SEG__ Chr8 {Bos taurus} MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP
RGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*
49 >lcl|XP_001249779.1|Plus1complement(2662189..2662569) NW_001493714 histone cluster 1, H2bd-like LOC781410 __SEG__ Chr1 {Bos taurus} MPEPVKSAPAPKKGSKKAVTKAQKKDGKKRKCSRKESYSVYVYKVRKQVHPDTYISSKAMGIMNSFLNDIFKCIAGEASRLAHYNKHSSITSREIQTAVRLLLPGELVKH
AMSEGTKAVTKYTSSK*
50 >lcl|XP_001249779.1|Plus1complement(2662189..2662569) NW_001493714 histone cluster 1, H2bd-like LOC781410 __SEG__ Chr1 {Bos taurus} MPEPVKSAPAPKKGSKKAVTKAQKKDGKKRKCSRKESYSVYVYKVRKQVHPDTYISSKAMGIMNSFLNDIFKCIAGEASRLAHYNKHSSITSREIQTAVRLLLPGELVKH
AMSEGTKAVTKYTSSK*
51 >lcl|XP_001249782.1|Plus1696342..696752 NW_001492891 H3 histone, family 3A LOC781566 __SEG__ Chr11 {Bos taurus} MARTKQTARKSTGGKAPRKQAATKATRKSAPSTGGVKKPHRYRPGTVALHEIRCYQKSTELLIRKLPFQRLVREIAQDFKTDLCFQSAAIGALQEASEAYLVGLFENTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
52 >lcl|XP_001249782.1|Plus1696342..696752 NW_001492891 H3 histone, family 3A LOC781566 __SEG__ Chr11 {Bos taurus} MARTKQTARKSTGGKAPRKQAATKATRKSAPSTGGVKKPHRYRPGTVALHEIRCYQKSTELLIRKLPFQRLVREIAQDFKTDLCFQSAAIGALQEASEAYLVGLFENTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
53 >lcl|XP_001249842.1|Plus14235914..4236294 NW_001494883 histone cluster 1, H2bd-like LOC781729 __SEG__ Chr4 {Bos taurus} MPELAKSAPAPKKGSKKAVTKAQKKDSKQHKRSHKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFEYIAGEASHLAHYNKCSTITSREIQTAVSLLLPGELAKH
AVSEGTKAVTKYTSSK*
54 >lcl|XP_001249842.1|Plus14235914..4236294 NW_001494883 histone cluster 1, H2bd-like LOC781729 __SEG__ Chr4 {Bos taurus} MPELAKSAPAPKKGSKKAVTKAQKKDSKQHKRSHKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFEYIAGEASHLAHYNKCSTITSREIQTAVSLLLPGELAKH
AVSEGTKAVTKYTSSK*
55 >lcl|XP_001249845.1|Plus1complement(1579904..1580215) NW_001495187 histone H4 replacement-like LOC781223 __SEG__ Chr6 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVTRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
56 >lcl|XP_001249845.1|Plus1complement(1579904..1580215) NW_001495187 histone H4 replacement-like LOC781223 __SEG__ Chr6 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVTRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
57 >lcl|XP_001249945.1|Plus13995540..3996715 NW_001494883 nucleosome assembly protein 1-like 1 LOC782609 __SEG__ Chr4 {Bos taurus} MADIDNKEQSELDQDLDDAEEVEEEETGEETNIKARQLTVQMMQNPQILAALQERLDGLVETPTGYVESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
QPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKVEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEP
NEYFTNEVLTKTYRMRSEPDDSDPFSFEGPEFMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDCFCNFFAPPEVPESGDLDDDSEAILAADFEIGHFL
HEHIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ*
58 >lcl|XP_001249945.1|Plus13995540..3996715 NW_001494883 nucleosome assembly protein 1-like 1 LOC782609 __SEG__ Chr4 {Bos taurus} MADIDNKEQSELDQDLDDAEEVEEEETGEETNIKARQLTVQMMQNPQILAALQERLDGLVETPTGYVESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
QPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKVEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEP
NEYFTNEVLTKTYRMRSEPDDSDPFSFEGPEFMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDCFCNFFAPPEVPESGDLDDDSEAILAADFEIGHFL
HEHIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ*
59 >lcl|XP_001250364.1|Plus1392520..393077 NW_001494553 heterochromatin protein 1-beta LOC783772 __SEG__ Chr2 {Bos taurus} MGKKQNKKKVEEVLEEKEEEYVVEKVLDRRVVKAKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEENKPKKKKEESEKP
RSFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*
60 >lcl|XP_001250364.1|Plus1392520..393077 NW_001494553 heterochromatin protein 1-beta LOC783772 __SEG__ Chr2 {Bos taurus} MGKKQNKKKVEEVLEEKEEEYVVEKVLDRRVVKAKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEENKPKKKKEESEKP
RSFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*
61 >lcl|XP_001251623.1|Plus11114166..1114546 NW_001494173 histone cluster 1, H2bd-like LOC782971 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
62 >lcl|XP_001251623.1|Plus11114166..1114546 NW_001494173 histone cluster 1, H2bd-like LOC782971 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
63 >lcl|XP_001252453.1|Plus1complement(1150165..1150551) NW_001494173 histone cluster 1, H2aj-like LOC783767 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTK*
64 >lcl|XP_001252453.1|Plus1complement(1150165..1150551) NW_001494173 histone cluster 1, H2aj-like LOC783767 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKTK*
65 >lcl|XP_001253340.1|Plus1583886..584266 NW_001494179 histone cluster 1, H2bd-like LOC787269 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
66 >lcl|XP_001253340.1|Plus1583886..584266 NW_001494179 histone cluster 1, H2bd-like LOC787269 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
67 >lcl|XP_001253526.1|Plus1complement(463795..464175) NW_001494179 histone cluster 1, H2bd-like LOC787465 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
68 >lcl|XP_001253526.1|Plus1complement(463795..464175) NW_001494179 histone cluster 1, H2bd-like LOC787465 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
69 >lcl|XP_001253549.1|Plus1458884..459195 NW_001494179 histone H4 replacement-like LOC787485 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
70 >lcl|XP_001253549.1|Plus1458884..459195 NW_001494179 histone H4 replacement-like LOC787485 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
71 >lcl|XP_001253589.1|Plus1454656..455066 NW_001494179 histone H3.1 H3.1 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
72 >lcl|XP_001253589.1|Plus1454656..455066 NW_001494179 histone H3.1 H3.1 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
73 >lcl|XP_001254220.1|Plus1661963..662373 NW_001494179 histone cluster 1, H3f-like LOC788250 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
74 >lcl|XP_001254220.1|Plus1661963..662373 NW_001494179 histone cluster 1, H3f-like LOC788250 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
75 >lcl|XP_001254838.2|Plus1934651..935040 NW_001494179 histone cluster 1, H2ac-like LOC787441 __SEG__ Chr23 {Bos taurus} MLGHKKQDGKAHAKTKSRSSRAGLHFPVGRIYRLPHKGNCAERVGAGEPVYLAAVLEYLMAEILESADNASHDKKKTRIIPCHLQLAIHNEELNKLLGGVTIQGCVLPKI
QPVLLPKKTGSHHHKVQSK*
76 >lcl|XP_001254838.2|Plus1934651..935040 NW_001494179 histone cluster 1, H2ac-like LOC787441 __SEG__ Chr23 {Bos taurus} MLGHKKQDGKAHAKTKSRSSRAGLHFPVGRIYRLPHKGNCAERVGAGEPVYLAAVLEYLMAEILESADNASHDKKKTRIIPCHLQLAIHNEELNKLLGGVTIQGCVLPKI
QPVLLPKKTGSHHHKVQSK*
77 >lcl|XP_001255500.1|Plus1511965..512357 NW_001494734 histone cluster 2, H2aa3-like LOC788724 __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRSGLQFPVGLVHRLLRKGNYAERVGAGAPVYMAVVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
78 >lcl|XP_001255500.1|Plus1511965..512357 NW_001494734 histone cluster 2, H2aa3-like LOC788724 __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRSGLQFPVGLVHRLLRKGNYAERVGAGAPVYMAVVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
79 >lcl|XP_001788832.1|Plus1<2079740..2080222 NW_001494731 histone cluster 1, H2bd-like LOC506306 __SEG__ Chr3 {Bos taurus} FAYSLYKYRVAAGPPGCSLLPSAFLVICAACVCSYARAGKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAG
EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK*
80 >lcl|XP_001788832.1|Plus1<2079740..2080222 NW_001494731 histone cluster 1, H2bd-like LOC506306 __SEG__ Chr3 {Bos taurus} FAYSLYKYRVAAGPPGCSLLPSAFLVICAACVCSYARAGKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAG
EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK*
81 >lcl|XP_001788836.1|Plus1<2153407..2153769 NW_001494731 histone cluster 2, H3c2-like LOC788077 __SEG__ Chr3 {Bos taurus} PRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
LARRIRGERA*
82 >lcl|XP_001788836.1|Plus1<2153407..2153769 NW_001494731 histone cluster 2, H3c2-like LOC788077 __SEG__ Chr3 {Bos taurus} PRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
LARRIRGERA*
83 >lcl|XP_001790064.1|Plus1complement(349435..349890) NW_001508751 H2B histone family, member W, testis-specific-like LOC784212 __SEG__ ChrX {Bos taurus} MENGGSVVSQPSPDGYEEDVITKETGTSETEPSETEMAKAETSKPEPCDAEPKKAKQKTANGRRRRRRHRHNDNFSRFATYFPRVLRQIHKGMSLSRDSVNILDSFVKDM
FERIAEEAGRLARNNKRRTITHEDIEAAVRLLLPGDLCSMP*
84 >lcl|XP_001790064.1|Plus1complement(349435..349890) NW_001508751 H2B histone family, member W, testis-specific-like LOC784212 __SEG__ ChrX {Bos taurus} MENGGSVVSQPSPDGYEEDVITKETGTSETEPSETEMAKAETSKPEPCDAEPKKAKQKTANGRRRRRRHRHNDNFSRFATYFPRVLRQIHKGMSLSRDSVNILDSFVKDM
FERIAEEAGRLARNNKRRTITHEDIEAAVRLLLPGDLCSMP*
85 >lcl|XP_002684120.1|Plus1complement(2079097..2079489) NW_001494731 histone cluster 2, H2aa3-like LOC100297758 __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
86 >lcl|XP_002684120.1|Plus1complement(2079097..2079489) NW_001494731 histone cluster 2, H2aa3-like LOC100297758 __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
87 >lcl|XP_002684244.1|Plus1complement(1762386..1762796) NW_001495330 H3 histone, family 3A LOC100297725 __SEG__ Chr7 {Bos taurus} MARTKQTASKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIIPKDIQLARRIRGERA*
88 >lcl|XP_002684244.1|Plus1complement(1762386..1762796) NW_001495330 H3 histone, family 3A LOC100297725 __SEG__ Chr7 {Bos taurus} MARTKQTASKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIIPKDIQLARRIRGERA*
89 >lcl|XP_002701047.1|Plus1complement(2779098..2779370) NW_001493093 histone cluster 1, H2bd-like LOC100296768 __SEG__ Chr13 {Bos taurus} MYSVYVYKVLKQVHPDTGISSKAMGIMNSFINDIFECIAGEASRLAHYNKRLTITSREIQTTVCLLPPGELAKHAVSEGSKAVTKYTSSK*
90 >lcl|XP_002701047.1|Plus1complement(2779098..2779370) NW_001493093 histone cluster 1, H2bd-like LOC100296768 __SEG__ Chr13 {Bos taurus} MYSVYVYKVLKQVHPDTGISSKAMGIMNSFINDIFECIAGEASRLAHYNKRLTITSREIQTTVCLLPPGELAKHAVSEGSKAVTKYTSSK*
91 >lcl|XP_002701340.1|Plus12329976..2330356 NW_001493278 histone cluster 1, H2bc-like LOC100300167 __SEG__ Chr15 {Bos taurus} MPELAKSSPAPKKGSKKSVTKAQKKDGKKCKHSRKESYSVYVYKVLKQVHPDTNISSKAIGIMNSFINDIFEHITGEALRLAHYNKRSTITSREIQTAVRLLLPGELVKH
TVSKGTKAVTKSTSSK*
92 >lcl|XP_002701340.1|Plus12329976..2330356 NW_001493278 histone cluster 1, H2bc-like LOC100300167 __SEG__ Chr15 {Bos taurus} MPELAKSSPAPKKGSKKSVTKAQKKDGKKCKHSRKESYSVYVYKVLKQVHPDTNISSKAIGIMNSFINDIFEHITGEALRLAHYNKRSTITSREIQTAVRLLLPGELVKH
TVSKGTKAVTKSTSSK*
93 >lcl|XP_002702930.1|Plus11097261..1097653 NW_001494173 histone cluster 1, H2ag-like LOC100294773 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
94 >lcl|XP_002702930.1|Plus11097261..1097653 NW_001494173 histone cluster 1, H2ag-like LOC100294773 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
95 >lcl|XP_002702931.1|Plus1complement(1143637..1144017) NW_001494173 histone H2B-like LOC616868 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
96 >lcl|XP_002702931.1|Plus1complement(1143637..1144017) NW_001494173 histone H2B-like LOC616868 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
97 >lcl|XP_002702932.1|Plus11150858..1151238 NW_001494173 histone cluster 1, H2bd-like LOC100295221 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
98 >lcl|XP_002702932.1|Plus11150858..1151238 NW_001494173 histone cluster 1, H2bd-like LOC100295221 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
99 >lcl|XP_002702970.1|Plus1930748..931131 NW_001494179 histone cluster 1, H2ba HIST1H2BA __SEG__ Chr23 {Bos taurus} MPELTTKGTTISKKGFKKAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVSDIFERVAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAK
HAVSEGTKAVTKYTSSK*
100 >lcl|XP_002702970.1|Plus1930748..931131 NW_001494179 histone cluster 1, H2ba HIST1H2BA __SEG__ Chr23 {Bos taurus} MPELTTKGTTISKKGFKKAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVSDIFERVAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAK
HAVSEGTKAVTKYTSSK*
101 >lcl|XP_002702971.1|Plus1complement(933889..934272) NW_001494179 histone H2B type 1-A-like LOC100335534 __SEG__ Chr23 {Bos taurus} MPELYSKGATISKKGFKKAVIKTQKKEGKKRRRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAK
HAVSEGTKAVTKYTSSK*
102 >lcl|XP_002702971.1|Plus1complement(933889..934272) NW_001494179 histone H2B type 1-A-like LOC100335534 __SEG__ Chr23 {Bos taurus} MPELYSKGATISKKGFKKAVIKTQKKEGKKRRRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAK
HAVSEGTKAVTKYTSSK*
103 >lcl|XP_002703370.1|Plus1complement(3222414..3222794) NW_001494432 histone cluster 1, H2bd-like LOC100295597 __SEG__ Chr27 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKCSCKESYSVYVYKVLKQVHLDTGISSKAMGITNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAMRLLLPGELAKQ
TVSEGTKAVTKYTSSK*
104 >lcl|XP_002703370.1|Plus1complement(3222414..3222794) NW_001494432 histone cluster 1, H2bd-like LOC100295597 __SEG__ Chr27 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKCSCKESYSVYVYKVLKQVHLDTGISSKAMGITNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAMRLLLPGELAKQ
TVSEGTKAVTKYTSSK*
105 >lcl|XP_002704703.1|Plus1330121..330906 NW_001495250 transcriptional adaptor 2B-like LOC515581 __SEG__ Chr6 {Bos taurus} MPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLRERQRRKNIARDYNLVPAFLGKDKKEKERAARRKVTKEEKELRLKLRPLYQFMSCKEFDDLFE
NMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAARHKREKRKENKAAAAAAAAAGGAKRGKEDGRDGEFAAIEHLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKD
HLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS*
106 >lcl|XP_002704703.1|Plus1330121..330906 NW_001495250 transcriptional adaptor 2B-like LOC515581 __SEG__ Chr6 {Bos taurus} MPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLRERQRRKNIARDYNLVPAFLGKDKKEKERAARRKVTKEEKELRLKLRPLYQFMSCKEFDDLFE
NMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAARHKREKRKENKAAAAAAAAAGGAKRGKEDGRDGEFAAIEHLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKD
HLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS*
107 >lcl|XP_002706757.1|Plus1complement(11394..>11681) NW_001504091 histone cluster 1, H2bd-like LOC100335411 __SEG__ Chr1 {Bos taurus} RSHRESYSMDVYKVLKQVYLDTSISSKAMGIMNSFVNDIFEGIAGEAWHLAHYNKHSTVTSREIQTALRLLLPGGLAKHAVSEGTEAVTKYTSSK*
108 >lcl|XP_002706757.1|Plus1complement(11394..>11681) NW_001504091 histone cluster 1, H2bd-like LOC100335411 __SEG__ Chr1 {Bos taurus} RSHRESYSMDVYKVLKQVYLDTSISSKAMGIMNSFVNDIFEGIAGEAWHLAHYNKHSTVTSREIQTALRLLLPGGLAKHAVSEGTEAVTKYTSSK*
109 >lcl|XP_002707343.1|Plus1399481..399861 NW_001508790 histone cluster 1, H2bd-like LOC100296541 __SEG__ ChrX {Bos taurus} MPEPAKSAPAPKKGSKKAMTKAQKKDGKKCKSSRKESYSVYVYKVLKQVHPDTSISSKAMGIMNSFVNDIFECITGEASCLAHYNKHSTITSREIQTAMLLLLPGELAKH
AVPEGTKAVTKYTSSK*
110 >lcl|XP_002707343.1|Plus1399481..399861 NW_001508790 histone cluster 1, H2bd-like LOC100296541 __SEG__ ChrX {Bos taurus} MPEPAKSAPAPKKGSKKAMTKAQKKDGKKCKSSRKESYSVYVYKVLKQVHPDTSISSKAMGIMNSFVNDIFECITGEASCLAHYNKHSTITSREIQTAMLLLLPGELAKH
AVPEGTKAVTKYTSSK*
111 >lcl|XP_581429.3|Plus1complement(450004..450384) NW_001494179 histone cluster 1, H2bd-like LOC505183 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
112 >lcl|XP_581429.3|Plus1complement(450004..450384) NW_001494179 histone cluster 1, H2bd-like LOC505183 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
113 >lcl|XP_582268.3|Plus1130367..130747 NW_001495394 histone cluster 1, H2bd-like LOC505903 __SEG__ Chr7 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDSKKRKSSRKESYSVYVYKVLKQVHLDTSISSKAMGIMNSFIKDIFQHITGEASCLVHYNKCSTITSREIQTSVRLLLPGELAKQ
AMSEGTKAVIKYTSSK*
114 >lcl|XP_582268.3|Plus1130367..130747 NW_001495394 histone cluster 1, H2bd-like LOC505903 __SEG__ Chr7 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDSKKRKSSRKESYSVYVYKVLKQVHLDTSISSKAMGIMNSFIKDIFQHITGEASCLVHYNKCSTITSREIQTSVRLLLPGELAKQ
AMSEGTKAVIKYTSSK*
115 >lcl|XP_582665.3|Plus12710200..2711738 NW_001493469 tigger transposable element derived 6-like LOC538784 __SEG__ Chr17 {Bos taurus} MAEAPVDASTLPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPML
RLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGVSADPSAVWHQNILPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFKGETCSIGKLCKDRITLVVGT
NMDGSEKLPLLLIGKNRNPRCFKGIQSLPVCYEANKMAWMTAEVFEQWMQKLDERFQAQQRRVVIFVESSPAHPEVKNLKSIELAFFPSCLSSKFIAMKQGVIRSLKIKY
RHCLIKKFLSSVEGSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEAGFKSQRGESEEASAETDTGLDLVADAQAAGVEFPEGLSVEEYAALDDDLETCEAAPSGDAVC
PKESESDETGFYTSDEEEDGGSLESELPLPSKNEAITALDTLKTFLRSQDINDELHNALADLEIFINSLSSK*
116 >lcl|XP_582665.3|Plus12710200..2711738 NW_001493469 tigger transposable element derived 6-like LOC538784 __SEG__ Chr17 {Bos taurus} MAEAPVDASTLPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPML
RLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGVSADPSAVWHQNILPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFKGETCSIGKLCKDRITLVVGT
NMDGSEKLPLLLIGKNRNPRCFKGIQSLPVCYEANKMAWMTAEVFEQWMQKLDERFQAQQRRVVIFVESSPAHPEVKNLKSIELAFFPSCLSSKFIAMKQGVIRSLKIKY
RHCLIKKFLSSVEGSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEAGFKSQRGESEEASAETDTGLDLVADAQAAGVEFPEGLSVEEYAALDDDLETCEAAPSGDAVC
PKESESDETGFYTSDEEEDGGSLESELPLPSKNEAITALDTLKTFLRSQDINDELHNALADLEIFINSLSSK*
117 >lcl|XP_583411.1|Plus1complement(583163..583555) NW_001494179 histone H2A isoform 1 LOC506900 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
118 >lcl|XP_583411.1|Plus1complement(583163..583555) NW_001494179 histone H2A isoform 1 LOC506900 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
119 >lcl|XP_588477.5|Plus1complement(717226..718017) NW_001508726 methyl CpG binding protein 2 (Rett syndrome) isoform 1 MECP2 __SEG__ ChrX {Bos taurus} MPFQAAPGSKAEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAATAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSG
KGLKTCKSPGRKSKESSPKGRSGSASSPPKKEHHHHHHHVEPPKAPAPLLLPPPPPPPEPQSSEDPASPPEPQDLSSSVCKEEKMPRAGSLESDGCPKEPAKTQPALATA
APATEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS*
120 >lcl|XP_588477.5|Plus1complement(717226..718017) NW_001508726 methyl CpG binding protein 2 (Rett syndrome) isoform 1 MECP2 __SEG__ ChrX {Bos taurus} MPFQAAPGSKAEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAATAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSG
KGLKTCKSPGRKSKESSPKGRSGSASSPPKKEHHHHHHHVEPPKAPAPLLLPPPPPPPEPQSSEDPASPPEPQDLSSSVCKEEKMPRAGSLESDGCPKEPAKTQPALATA
APATEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS*
121 >lcl|XP_589056.1|Plus1complement(2856784..2858358) NW_001493278 tigger transposable element derived 6-like JRKL __SEG__ Chr15 {Bos taurus} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPVSGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLSGDETAVEDFCSNFRDYIERENLQPEQIYNADETGLFWKCLPSRTSVIKGKCTVPGHKSMEERVTIMCCANATGL
HKLKLCVVGKAKKPRSFKSTDTSNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREHLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLNQGV
IATMKRNYRARLLQNNLEEGNDLRSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPTIEEKEGLDFDEEDISVAAIATILQHTKGLENVPTENIEKWLEVDSTEPG
YEVLTDSEIIKRAQGHTDESSENEEEEIELIPEKHINHAAALQWTENLLDYLEQQGDMILPDRLVIRKLRATIRNKQKMANSSQ*
122 >lcl|XP_589056.1|Plus1complement(2856784..2858358) NW_001493278 tigger transposable element derived 6-like JRKL __SEG__ Chr15 {Bos taurus} MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPVSGPICAKRAEFFF
YALGMDGDFNPSAGWLTRFKQRHSIREINIRNERLSGDETAVEDFCSNFRDYIERENLQPEQIYNADETGLFWKCLPSRTSVIKGKCTVPGHKSMEERVTIMCCANATGL
HKLKLCVVGKAKKPRSFKSTDTSNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREHLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLNQGV
IATMKRNYRARLLQNNLEEGNDLRSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPTIEEKEGLDFDEEDISVAAIATILQHTKGLENVPTENIEKWLEVDSTEPG
YEVLTDSEIIKRAQGHTDESSENEEEEIELIPEKHINHAAALQWTENLLDYLEQQGDMILPDRLVIRKLRATIRNKQKMANSSQ*
123 >lcl|XP_590015.2|Plus11147518..1147928 NW_001494173 histone cluster 1, H3f-like LOC539875 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
124 >lcl|XP_590015.2|Plus11147518..1147928 NW_001494173 histone cluster 1, H3f-like LOC539875 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
125 >lcl|XP_590158.1|Plus11774380..1774760 NW_001494491 histone cluster 1, H2bc-like LOC512612 __SEG__ Chr29 {Bos taurus} MPEPAKSAAAPKKGSKKAVTKAQKKDGKKRKRSRKESYSSYVYKVLKQVHPDTSISSKATGIMNSFVNDIFQRITGEASRLAHYNKRSTITSREIQTAVCLLLPGELAKH
AVSEGTKAVTKYTSSK*
126 >lcl|XP_590158.1|Plus11774380..1774760 NW_001494491 histone cluster 1, H2bc-like LOC512612 __SEG__ Chr29 {Bos taurus} MPEPAKSAAAPKKGSKKAVTKAQKKDGKKRKRSRKESYSSYVYKVLKQVHPDTSISSKATGIMNSFVNDIFQRITGEASRLAHYNKRSTITSREIQTAVCLLLPGELAKH
AVSEGTKAVTKYTSSK*
127 >lcl|XP_590891.3|Plus1451633..453048 NW_001494538 tigger transposable element derived 3 LOC513236 __SEG__ Chr29 {Bos taurus} MELCGKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELA
DILGQDFVPSIGWLVRWKRRNNVGFGARHILAPPFPPEPPPPAPTPQAQLPLSLKDFSPEDIFGCVEVPLLYRAVPGRAGTCDRVQVLLCANSRGTEKRRLLVCGPQAAP
RCFFGVSSEALPASYHPDLAIPWSEWLSQFDRDMGRQGRQVALLMAAQVVEEVAGLPGLCHVRLLPLSAASPTQPLPSSVVRAFKAHYRRRLLSKLAAAQSERACTLLAE
IGAGITVLDALHMAAAAWAKVPLQLIVSSFIQEGLAPGKTPVAQDQASEVLQVPGGLSLEEFSRFVDLESEEPVSGACKEEVGPADEAGGGEDGFEPLPTKADALQALGT
LRRWLECSGTTPELFENFYACEEGVERLCCL*
128 >lcl|XP_590891.3|Plus1451633..453048 NW_001494538 tigger transposable element derived 3 LOC513236 __SEG__ Chr29 {Bos taurus} MELCGKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELA
DILGQDFVPSIGWLVRWKRRNNVGFGARHILAPPFPPEPPPPAPTPQAQLPLSLKDFSPEDIFGCVEVPLLYRAVPGRAGTCDRVQVLLCANSRGTEKRRLLVCGPQAAP
RCFFGVSSEALPASYHPDLAIPWSEWLSQFDRDMGRQGRQVALLMAAQVVEEVAGLPGLCHVRLLPLSAASPTQPLPSSVVRAFKAHYRRRLLSKLAAAQSERACTLLAE
IGAGITVLDALHMAAAAWAKVPLQLIVSSFIQEGLAPGKTPVAQDQASEVLQVPGGLSLEEFSRFVDLESEEPVSGACKEEVGPADEAGGGEDGFEPLPTKADALQALGT
LRRWLECSGTTPELFENFYACEEGVERLCCL*
129 >lcl|XP_591827.1|Plus1388059..388469 NW_001494179 histone cluster 1, H3f-like LOC540148 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
130 >lcl|XP_591827.1|Plus1388059..388469 NW_001494179 histone cluster 1, H3f-like LOC540148 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
131 >lcl|XP_593622.2|Plus1329899..330906 NW_001495250 transcriptional adaptor 2B-like isoform 2 LOC515581 __SEG__ Chr6 {Bos taurus} MAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELK
RAHVDMYVRKLRERQRRKNIARDYNLVPAFLGKDKKEKERAARRKVTKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAAR
HKREKRKENKAAAAAAAAAGGAKRGKEDGRDGEFAAIEHLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWI
SRDAS*
132 >lcl|XP_593622.2|Plus1329899..330906 NW_001495250 transcriptional adaptor 2B-like isoform 2 LOC515581 __SEG__ Chr6 {Bos taurus} MAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELK
RAHVDMYVRKLRERQRRKNIARDYNLVPAFLGKDKKEKERAARRKVTKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAAR
HKREKRKENKAAAAAAAAAGGAKRGKEDGRDGEFAAIEHLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWI
SRDAS*
133 >lcl|XP_593945.4|Plus1complement(923465..925396) NW_001493178 tigger transposable element derived 5-like LOC540422 __SEG__ Chr14 {Bos taurus} MYSAGPPAVPAPRRCRRPPPGRPMQPPRPPAPAPVPAARPPPPAPGPRPRVAVKMAFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQL
GGEVGTQRKKMRLANEEEIDRAVYSWFLALRQHGVPLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPVAAGPAPGPPVNQEPAQPTRAGP
LPDRAASTPAPAEGGYGDEQIYNANVTGLYWKLLPEQAAPVGAGGCGRRWRGDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRG
WFFEEFVPGVRRYLRRSCLQQKAVLLVAHPPCPSSEARMPALEESEETRRRCRPEPTGPPEELQTPDGAVRVLFLCRGSGRAHIPAPLEQGVVAAFKQLYKRELLRLAVS
CAGGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPVEERAGQPAGQAEEAAEHSRVLSDLTHLAALAYKRLAPEEVAEWLHLDDDGGLPDGGRED
WGPSRPPVLVPGGPLLPASLPSAVAGGAEEEEEEAIPTAGEAVRGLETALRWLETQDPREVGPLKLVQLRSLISTARRLGGIGPSPMVPDDGL*
134 >lcl|XP_593945.4|Plus1complement(923465..925396) NW_001493178 tigger transposable element derived 5-like LOC540422 __SEG__ Chr14 {Bos taurus} MYSAGPPAVPAPRRCRRPPPGRPMQPPRPPAPAPVPAARPPPPAPGPRPRVAVKMAFRKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQL
GGEVGTQRKKMRLANEEEIDRAVYSWFLALRQHGVPLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPVAAGPAPGPPVNQEPAQPTRAGP
LPDRAASTPAPAEGGYGDEQIYNANVTGLYWKLLPEQAAPVGAGGCGRRWRGDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRG
WFFEEFVPGVRRYLRRSCLQQKAVLLVAHPPCPSSEARMPALEESEETRRRCRPEPTGPPEELQTPDGAVRVLFLCRGSGRAHIPAPLEQGVVAAFKQLYKRELLRLAVS
CAGGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPVEERAGQPAGQAEEAAEHSRVLSDLTHLAALAYKRLAPEEVAEWLHLDDDGGLPDGGRED
WGPSRPPVLVPGGPLLPASLPSAVAGGAEEEEEEAIPTAGEAVRGLETALRWLETQDPREVGPLKLVQLRSLISTARRLGGIGPSPMVPDDGL*
135 >lcl|XP_594900.2|Plus1complement(2160779..2161090) NW_001494731 histone H4 replacement-like LOC516742 __SEG__ Chr3 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
136 >lcl|XP_594900.2|Plus1complement(2160779..2161090) NW_001494731 histone H4 replacement-like LOC516742 __SEG__ Chr3 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
137 >lcl|XP_595302.1|Plus1complement(677062..677373) NW_001494179 histone H4 replacement-like LOC517138 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
138 >lcl|XP_595302.1|Plus1complement(677062..677373) NW_001494179 histone H4 replacement-like LOC517138 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
139 >lcl|XP_595303.1|Plus1complement(678130..678540) NW_001494179 histone cluster 1, H3f-like LOC517139 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
140 >lcl|XP_595303.1|Plus1complement(678130..678540) NW_001494179 histone cluster 1, H3f-like LOC517139 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
141 >lcl|XP_595652.1|Plus11108034..1108345 NW_001494173 histone H4 replacement-like isoform 1 LOC517481 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
142 >lcl|XP_595652.1|Plus11108034..1108345 NW_001494173 histone H4 replacement-like isoform 1 LOC517481 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
143 >lcl|XP_595799.2|Plus1complement(7302..8888) NW_001493183 jerky homolog JRK __SEG__ Chr14 {Bos taurus} MASKPAAGRSPGEKRKRVVLTLKEKMDICRRLEKGESRRALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSDKALAQRRTLHTPKLEHLDRVLYEWFLVKRSEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADQQAAEQFCGFFRSLTAEHGLSPEQVYNADETGLFWRCSPSPSPEGGSAPGPTQSKDRLTVLM
CANATGSHRIKPLVVGKWGSPKAVQGLQHLPVVYKAQGSAWVDKEIFADWFHHIFVPAVKEHFRAMALPEDSKAILLLDGSRAHPREAELASENVFTIFLPASVTALLQP
MDQGIRRDFMRNFVTPRGRLQALAPRCSVQDAVLDVACAWDAVPGAVLSRAWRKLWPEAALTEGSSSEEEPERLRTKPPDQAFTHTPGLTAGAPAHLGSAALGSLEPAEA
GGVDRAAWEQAAVSFDALVRFAEAQPCFSVQELGQLRALRSVFSRRWQAQRGRAPAAAVKLEAPWERPGPCGTQPCSPLPGSSTAGEA*
144 >lcl|XP_595799.2|Plus1complement(7302..8888) NW_001493183 jerky homolog JRK __SEG__ Chr14 {Bos taurus} MASKPAAGRSPGEKRKRVVLTLKEKMDICRRLEKGESRRALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSDKALAQRRTLHTPKLEHLDRVLYEWFLVKRSEGVPVSGP
MLIEKAKDFYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADQQAAEQFCGFFRSLTAEHGLSPEQVYNADETGLFWRCSPSPSPEGGSAPGPTQSKDRLTVLM
CANATGSHRIKPLVVGKWGSPKAVQGLQHLPVVYKAQGSAWVDKEIFADWFHHIFVPAVKEHFRAMALPEDSKAILLLDGSRAHPREAELASENVFTIFLPASVTALLQP
MDQGIRRDFMRNFVTPRGRLQALAPRCSVQDAVLDVACAWDAVPGAVLSRAWRKLWPEAALTEGSSSEEEPERLRTKPPDQAFTHTPGLTAGAPAHLGSAALGSLEPAEA
GGVDRAAWEQAAVSFDALVRFAEAQPCFSVQELGQLRALRSVFSRRWQAQRGRAPAAAVKLEAPWERPGPCGTQPCSPLPGSSTAGEA*
145 >lcl|XP_596308.4|Plus1complement(1327630..1328274) NW_001495368 histone 4-like LOC518124 __SEG__ Chr7 {Bos taurus} MTEGLSSQGVYTWPQVPSPSPLGWGSPPPPLELLPSTASRTPGTCRVSHQCTFVHLHICRAGLHHEISLKASPPHTSYGYEFSLLSCCQAAIGPRRDSHGAVLQPQKLGF
TSREAMSGRGKSSKGLGKGGAKRHHKVLRDNIQGITKPAIRRLPRHGGMKRVSGIIYEETRGVLKVFLENVIWDVGTYTEHARLRAGIREVPCMQVASLNLSSV*
146 >lcl|XP_596308.4|Plus1complement(1327630..1328274) NW_001495368 histone 4-like LOC518124 __SEG__ Chr7 {Bos taurus} MTEGLSSQGVYTWPQVPSPSPLGWGSPPPPLELLPSTASRTPGTCRVSHQCTFVHLHICRAGLHHEISLKASPPHTSYGYEFSLLSCCQAAIGPRRDSHGAVLQPQKLGF
TSREAMSGRGKSSKGLGKGGAKRHHKVLRDNIQGITKPAIRRLPRHGGMKRVSGIIYEETRGVLKVFLENVIWDVGTYTEHARLRAGIREVPCMQVASLNLSSV*
147 >lcl|XP_596506.3|Plus1981752..982162 NW_001495310 histone cluster 1, H3f-like LOC518318 __SEG__ Chr7 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGMKKPHRYRPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
148 >lcl|XP_596506.3|Plus1981752..982162 NW_001495310 histone cluster 1, H3f-like LOC518318 __SEG__ Chr7 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGMKKPHRYRPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
149 >lcl|XP_597168.2|Plus1complement(409521..409832) NW_001494179 histone H4 replacement-like isoform 1 LOC518961 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
150 >lcl|XP_597168.2|Plus1complement(409521..409832) NW_001494179 histone H4 replacement-like isoform 1 LOC518961 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
151 >lcl|XP_597277.3|Plus1complement(3638517..3638891) NW_001493102 histone cluster 1, H2bd-like LOC519069 __SEG__ Chr13 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKDGKKRKRSRKESYSVYVYKVLKQVHPDTGILSKAMGIMNSVNDIFERIAGEASRLEHYNKRSTITSREIQTALRLLLPGELTKHAV
SEGTKAATKYTSSR*
152 >lcl|XP_597277.3|Plus1complement(3638517..3638891) NW_001493102 histone cluster 1, H2bd-like LOC519069 __SEG__ Chr13 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKDGKKRKRSRKESYSVYVYKVLKQVHPDTGILSKAMGIMNSVNDIFERIAGEASRLEHYNKRSTITSREIQTALRLLLPGELTKHAV
SEGTKAATKYTSSR*
153 >lcl|XP_598274.3|Plus1complement(2064659..2065039) NW_001493342 histone cluster 1, H2bc-like LOC520044 __SEG__ Chr15 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDSKKRKRSHKESYTVYVYKVLKQVHPDTGISSKAMGIMNSCVSDIFERISGEASRLAHYNKSSTIISREIQTAMRLLLPGELAKH
AVSEGTKAVTKYTSSK*
154 >lcl|XP_598274.3|Plus1complement(2064659..2065039) NW_001493342 histone cluster 1, H2bc-like LOC520044 __SEG__ Chr15 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDSKKRKRSHKESYTVYVYKVLKQVHPDTGISSKAMGIMNSCVSDIFERISGEASRLAHYNKSSTIISREIQTAMRLLLPGELAKH
AVSEGTKAVTKYTSSK*
155 >lcl|XP_598354.2|Plus1complement(925071..925451) NW_001495310 histone cluster 1, H2bo-like LOC520120 __SEG__ Chr7 {Bos taurus} MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
156 >lcl|XP_598354.2|Plus1complement(925071..925451) NW_001495310 histone cluster 1, H2bo-like LOC520120 __SEG__ Chr7 {Bos taurus} MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
157 >lcl|XP_599363.5|Plus142444..43865 NW_001495212 UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) UTP3 __SEG__ Chr6 {Bos taurus} MVGRSGRRARGAAKWAAVRAKASRDPADDDGEDLESPPSPGDSSYYQDKVDDFHEARSRAALAKGWSEIESGDEEDGDEEEEVLALDVADEDDEDGESEEGDDDDGGSSV
QSETEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEVEEEEREEEAEAQLIQRRLAQALQEDDFGVTWVEAFAKPVPQVNEAETRVVKDLAKVSVKEKLKMLRKESPE
LLELIDDLKVKLTEMKDELEPLLQLVEQKIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRYMLTLKDGAGKK
ELNLKAKSMKAKPKSVSETSAAALAVRDLSDDSDFDEEAALKYYKEMEERQKLKRKKEENSTEEQALEDQNAKRAITYQIAKIGDLHLGERKLIGIPESNTGRSSEKPKF
AEEARFVKFAGKSNVILVNCLAFVQELKRALSLS
158 >lcl|XP_599363.5|Plus142444..43865 NW_001495212 UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) UTP3 __SEG__ Chr6 {Bos taurus} MVGRSGRRARGAAKWAAVRAKASRDPADDDGEDLESPPSPGDSSYYQDKVDDFHEARSRAALAKGWSEIESGDEEDGDEEEEVLALDVADEDDEDGESEEGDDDDGGSSV
QSETEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEVEEEEREEEAEAQLIQRRLAQALQEDDFGVTWVEAFAKPVPQVNEAETRVVKDLAKVSVKEKLKMLRKESPE
LLELIDDLKVKLTEMKDELEPLLQLVEQKIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRYMLTLKDGAGKK
ELNLKAKSMKAKPKSVSETSAAALAVRDLSDDSDFDEEAALKYYKEMEERQKLKRKKEENSTEEQALEDQNAKRAITYQIAKIGDLHLGERKLIGIPESNTGRSSEKPKF
AEEARFVKFAGKSNVILVNCLAFVQELKRALSLS
159 >lcl|XP_599789.3|Plus11182889..1183269 NW_001495009 histone cluster 1, H2bl-like LOC521525 __SEG__ Chr5 {Bos taurus} MPELAKSAPAPRKGSKKAVTKAQNKDGKKRKCNCKESYSVYVYKVLKQVHPDTSISSKAMGIMNSFVNDIFKRIAGEAWHLAHYNKRSTITSREIHTAVHLLLPGELAKH
AVSEGTKAVTKYTSSK*
160 >lcl|XP_599789.3|Plus11182889..1183269 NW_001495009 histone cluster 1, H2bl-like LOC521525 __SEG__ Chr5 {Bos taurus} MPELAKSAPAPRKGSKKAVTKAQNKDGKKRKCNCKESYSVYVYKVLKQVHPDTSISSKAMGIMNSFVNDIFKRIAGEAWHLAHYNKRSTITSREIHTAVHLLLPGELAKH
AVSEGTKAVTKYTSSK*
161 >lcl|XP_599845.2|Plus1complement(396466..396846) NW_001494179 histone cluster 1, H2bd-like LOC521580 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
162 >lcl|XP_599845.2|Plus1complement(396466..396846) NW_001494179 histone cluster 1, H2bd-like LOC521580 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
163 >lcl|XP_599846.2|Plus1398157..398567 NW_001494179 histone cluster 1, H3f-like LOC521581 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
164 >lcl|XP_599846.2|Plus1398157..398567 NW_001494179 histone cluster 1, H3f-like LOC521581 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
165 >lcl|XP_601249.1|Plus143506..43886 NW_001494179 histone cluster 1, H2bj-like LOC522960 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSAK*
166 >lcl|XP_601249.1|Plus143506..43886 NW_001494179 histone cluster 1, H2bj-like LOC522960 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSAK*
167 >lcl|XP_601510.2|Plus1complement(421605..422015) NW_001494179 histone cluster 1, H3f-like LOC523214 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
168 >lcl|XP_601510.2|Plus1complement(421605..422015) NW_001494179 histone cluster 1, H3f-like LOC523214 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
169 >lcl|XP_601757.1|Plus1complement(292882..293373) NW_001508751 histone cluster 1, H2bl-like LOC523458 __SEG__ ChrX {Bos taurus} MAQPSSDNSEEDPGTNEAGTSKTEPSETEPSETETSESEPSEPEPYDAKPKKAKRKTAKGRRHRRRCHQDNFASFATYFRRVLKQVHTGLSLSHEAMNVMHSFVKHMFEQ
IAEEAGSLAHSSKHCTITSGEIQRAVRLLLPGEIGKHAVSEATKSVIRYNTRR*
170 >lcl|XP_601757.1|Plus1complement(292882..293373) NW_001508751 histone cluster 1, H2bl-like LOC523458 __SEG__ ChrX {Bos taurus} MAQPSSDNSEEDPGTNEAGTSKTEPSETEPSETETSESEPSEPEPYDAKPKKAKRKTAKGRRHRRRCHQDNFASFATYFRRVLKQVHTGLSLSHEAMNVMHSFVKHMFEQ
IAEEAGSLAHSSKHCTITSGEIQRAVRLLLPGEIGKHAVSEATKSVIRYNTRR*
171 >lcl|XP_602005.5|Plus1155668..156048 NW_001495533 histone cluster 1, H2bd-like LOC523702 __SEG__ Chr9 {Bos taurus} MPELAKSAPAPKKGSKKAVTKAQKKDGKKHKHNRKENHSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFEPIAGEASHLVHYYKRSNITSREIQTAVRLLLLGELGKH
AMSEGTKAVTKYTSSK*
172 >lcl|XP_602005.5|Plus1155668..156048 NW_001495533 histone cluster 1, H2bd-like LOC523702 __SEG__ Chr9 {Bos taurus} MPELAKSAPAPKKGSKKAVTKAQKKDGKKHKHNRKENHSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFEPIAGEASHLVHYYKRSNITSREIQTAVRLLLLGELGKH
AMSEGTKAVTKYTSSK*
173 >lcl|XP_602496.2|Plus13648352..3648744 NW_001493161 histone cluster 1, H2ag-like LOC524176 __SEG__ Chr13 {Bos taurus} MSGRGKQGGKARAKARTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
174 >lcl|XP_602496.2|Plus13648352..3648744 NW_001493161 histone cluster 1, H2ag-like LOC524176 __SEG__ Chr13 {Bos taurus} MSGRGKQGGKARAKARTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
175 >lcl|XP_603142.2|Plus1complement(442650..443042) NW_001494179 histone cluster 1, H2ae-like LOC524808 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
176 >lcl|XP_603142.2|Plus1complement(442650..443042) NW_001494179 histone cluster 1, H2ae-like LOC524808 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
177 >lcl|XP_603864.2|Plus1complement(652017..652427) NW_001494179 histone cluster 1, H3f-like LOC525511 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
178 >lcl|XP_603864.2|Plus1complement(652017..652427) NW_001494179 histone cluster 1, H3f-like LOC525511 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
179 >lcl|XP_603865.1|Plus1654136..654516 NW_001494179 histone cluster 1, H2bb-like LOC525512 __SEG__ Chr23 {Bos taurus} MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
180 >lcl|XP_603865.1|Plus1654136..654516 NW_001494179 histone cluster 1, H2bb-like LOC525512 __SEG__ Chr23 {Bos taurus} MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
181 >lcl|XP_604423.2|Plus1complement(2133040..2133420) NW_001495135 histone cluster 1, H2bl-like LOC526064 __SEG__ Chr6 {Bos taurus} MPELAKSAPAPKKGSKKSCDQGPEEGGKKRKCSHKESYSMYVYKVLKQVHPDTGISSKAMGIMNSFINDIFERITDKASHLEHYNKCSTITSREIQTAMCLLLHGELAKH
TLSKGTNAVTKYTSSK*
182 >lcl|XP_604423.2|Plus1complement(2133040..2133420) NW_001495135 histone cluster 1, H2bl-like LOC526064 __SEG__ Chr6 {Bos taurus} MPELAKSAPAPKKGSKKSCDQGPEEGGKKRKCSHKESYSMYVYKVLKQVHPDTGISSKAMGIMNSFINDIFERITDKASHLEHYNKCSTITSREIQTAMCLLLHGELAKH
TLSKGTNAVTKYTSSK*
183 >lcl|XP_604589.3|Plus1930664..930975 NW_001493846 histone H4 replacement-like LOC526226 __SEG__ Chr1 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARHGGVKRISGLIYEETRGVLKVFLENVIRDAVTYMEHAKRKTVTAMDVVYALKRQGCTLYGFGG*
184 >lcl|XP_604589.3|Plus1930664..930975 NW_001493846 histone H4 replacement-like LOC526226 __SEG__ Chr1 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARHGGVKRISGLIYEETRGVLKVFLENVIRDAVTYMEHAKRKTVTAMDVVYALKRQGCTLYGFGG*
185 >lcl|XP_605163.2|Plus13109976..3110287 NW_001493890 histone H4 replacement-like LOC526789 __SEG__ Chr1 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
186 >lcl|XP_605163.2|Plus13109976..3110287 NW_001493890 histone H4 replacement-like LOC526789 __SEG__ Chr1 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
187 >lcl|XP_605298.3|Plus1complement(2326220..2326603) NW_001493616 histone cluster 1, H2bd-like LOC526915 __SEG__ Chr18 {Bos taurus} MPEPAKSAPAPKKGSKKAMTKAQKDSKKRKRSRKESYSVYVYKVLKQVHPDTGILSKAMGIMNSFVNDIFVCITGEAWHLAHYNKRSTITSREIQTAVLLLLPGELAKHA
VSEGTKAVTKYTSSKYI*
188 >lcl|XP_605298.3|Plus1complement(2326220..2326603) NW_001493616 histone cluster 1, H2bd-like LOC526915 __SEG__ Chr18 {Bos taurus} MPEPAKSAPAPKKGSKKAMTKAQKDSKKRKRSRKESYSVYVYKVLKQVHPDTGILSKAMGIMNSFVNDIFVCITGEAWHLAHYNKRSTITSREIQTAVLLLLPGELAKHA
VSEGTKAVTKYTSSKYI*
189 >lcl|XP_605634.1|Plus1546361..546741 NW_001494179 histone cluster 1, H2bd-like LOC527244 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
190 >lcl|XP_605634.1|Plus1546361..546741 NW_001494179 histone cluster 1, H2bd-like LOC527244 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
191 >lcl|XP_605779.2|Plus1403501..403812 NW_001494179 histone H4 replacement-like LOC527388 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
192 >lcl|XP_605779.2|Plus1403501..403812 NW_001494179 histone H4 replacement-like LOC527388 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
193 >lcl|XP_606749.2|Plus11131016..1131327 NW_001494173 histone H4 replacement-like LOC528329 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
194 >lcl|XP_606749.2|Plus11131016..1131327 NW_001494173 histone H4 replacement-like LOC528329 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
195 >lcl|XP_606762.5|Plus11415365..1415745 NW_001508715 histone cluster 1, H2bd-like LOC528342 __SEG__ ChrX {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGEKRKHSRKESCSMYVYKVLKQVHLDTSISSKAMGIMNSFVNDIFECIAGEASCLAHYNKRSTITSRDIQTAVCLLLHRELAKH
AVSEGTKAVTKYTSSK*
196 >lcl|XP_606762.5|Plus11415365..1415745 NW_001508715 histone cluster 1, H2bd-like LOC528342 __SEG__ ChrX {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGEKRKHSRKESCSMYVYKVLKQVHLDTSISSKAMGIMNSFVNDIFECIAGEASCLAHYNKRSTITSRDIQTAVCLLLHRELAKH
AVSEGTKAVTKYTSSK*
197 >lcl|XP_607721.2|Plus1complement(1113468..1113860) NW_001494173 histone cluster 1, H2ag-like LOC529277 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
198 >lcl|XP_607721.2|Plus1complement(1113468..1113860) NW_001494173 histone cluster 1, H2ag-like LOC529277 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
199 >lcl|XP_608099.1|Plus1complement(385041..385421) NW_001494179 histone cluster 1, H2bd-like LOC529646 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
200 >lcl|XP_608099.1|Plus1complement(385041..385421) NW_001494179 histone cluster 1, H2bd-like LOC529646 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
201 >lcl|XP_608100.3|Plus1381013..381324 NW_001494179 histone H4 replacement-like LOC529647 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
202 >lcl|XP_608100.3|Plus1381013..381324 NW_001494179 histone H4 replacement-like LOC529647 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
203 >lcl|XP_610149.1|Plus11116521..1117108 NW_001508755 H2B histone family, member W, testis-specific-like LOC531650 __SEG__ ChrX {Bos taurus} MGIGGSILSETSSDSYEEDVITKETGISEIEPSEKEMAKVETSKPDPYDAEPIKVETSKPDPYDAEPKKAETSKPDPYDAEPKKAKQKTAKGRRRRRHCHHDSFSSFATY
FPRVLRQIHKGMSLSHDSVNILDSFVKDTFERIAEEAGRLAGDNKRRTITTEDIEAAVRLLLPGKLGKYAVLKATKSLITYRTCK*
204 >lcl|XP_610149.1|Plus11116521..1117108 NW_001508755 H2B histone family, member W, testis-specific-like LOC531650 __SEG__ ChrX {Bos taurus} MGIGGSILSETSSDSYEEDVITKETGISEIEPSEKEMAKVETSKPDPYDAEPIKVETSKPDPYDAEPKKAETSKPDPYDAEPKKAKQKTAKGRRRRRHCHHDSFSSFATY
FPRVLRQIHKGMSLSHDSVNILDSFVKDTFERIAEEAGRLAGDNKRRTITTEDIEAAVRLLLPGKLGKYAVLKATKSLITYRTCK*
205 >lcl|XP_610495.1|Plus11821393..1821803 NW_001494660 histone cluster 2, H3c2-like LOC531990 __SEG__ Chr2 {Bos taurus} MTRTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
206 >lcl|XP_610495.1|Plus11821393..1821803 NW_001494660 histone cluster 2, H3c2-like LOC531990 __SEG__ Chr2 {Bos taurus} MTRTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
207 >lcl|XP_614586.2|Plus1complement(536457..536849) NW_001495133 histone cluster 2, H2aa3-like LOC541108 __SEG__ Chr6 {Bos taurus} MSGRGKQGGKARAKAKSRSSRSGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAVVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
208 >lcl|XP_614586.2|Plus1complement(536457..536849) NW_001495133 histone cluster 2, H2aa3-like LOC541108 __SEG__ Chr6 {Bos taurus} MSGRGKQGGKARAKAKSRSSRSGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAVVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
209 >lcl|XP_869379.2|Plus139776..40951 NW_001495210 nucleosome assembly protein 1-like 1 isoform 6 LOC613882 __SEG__ Chr6 {Bos taurus} MADIDNKEQSELDQDLDDVEEVEEEETGEETKIKARQLTVQVMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
QPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKVEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFALEFHFEP
NEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDSEAILAADFEIGHFL
RERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ*
210 >lcl|XP_869379.2|Plus139776..40951 NW_001495210 nucleosome assembly protein 1-like 1 isoform 6 LOC613882 __SEG__ Chr6 {Bos taurus} MADIDNKEQSELDQDLDDVEEVEEEETGEETKIKARQLTVQVMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
QPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKVEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFALEFHFEP
NEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDSEAILAADFEIGHFL
RERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ*
211 >lcl|XP_869927.4|Plus1775143..775520 NW_003101171 histone cluster 1, H2bo-like LOC613752 __SEG__ Chr10 {Bos taurus} MPEPAKSAPAPKKGSKKAVTEAQKKDSKKRKRSCKEGYSMYVYKVLKQVHPDTGISSKAMEVMNSFVNIFEPIAGEASRLAHYNKRSTIISREIQTAVCLLLPGELAKHT
VSEGTKAVTKYTSSK*
212 >lcl|XP_869927.4|Plus1775143..775520 NW_003101171 histone cluster 1, H2bo-like LOC613752 __SEG__ Chr10 {Bos taurus} MPEPAKSAPAPKKGSKKAVTEAQKKDSKKRKRSCKEGYSMYVYKVLKQVHPDTGISSKAMEVMNSFVNIFEPIAGEASRLAHYNKRSTIISREIQTAVCLLLPGELAKHT
VSEGTKAVTKYTSSK*
213 >lcl|XP_870241.2|Plus1450707..451099 NW_001494179 histone cluster 1, H2ag-like LOC613926 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
214 >lcl|XP_870241.2|Plus1450707..451099 NW_001494179 histone cluster 1, H2ag-like LOC613926 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
215 >lcl|XP_870495.1|Plus11216310..1217494 NW_001493128 nucleosome assembly protein 1-like 1 isoform 1 LOC614124 __SEG__ Chr13 {Bos taurus} MADIDNKEQSELDQDLDDVEEVEEEETGEETKIKAHQLTVQMMQNPQILAALQERLDGLVETPTGYAESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYSVLY
QPLFDKRFEIINAIYEPTEEECEWKPGEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDTVQEHDEPILKYLKDIKVKFSDAGQPMSFVLEFHFEP
NEYFTNEVLTKTYRMRSEPQGSDDSDPFSFDGPEIMGCTGCQIDCKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPETGDLDDDSEAILAADFEIG
HFLREHIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDCDPKKDQNPAECKQQ*
216 >lcl|XP_870495.1|Plus11216310..1217494 NW_001493128 nucleosome assembly protein 1-like 1 isoform 1 LOC614124 __SEG__ Chr13 {Bos taurus} MADIDNKEQSELDQDLDDVEEVEEEETGEETKIKAHQLTVQMMQNPQILAALQERLDGLVETPTGYAESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYSVLY
QPLFDKRFEIINAIYEPTEEECEWKPGEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDTVQEHDEPILKYLKDIKVKFSDAGQPMSFVLEFHFEP
NEYFTNEVLTKTYRMRSEPQGSDDSDPFSFDGPEIMGCTGCQIDCKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPETGDLDDDSEAILAADFEIG
HFLREHIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDCDPKKDQNPAECKQQ*
217 >lcl|XP_870697.2|Plus11290586..1290966 NW_001493950 histone cluster 1, H2bd-like LOC614206 __SEG__ Chr20 {Bos taurus} MPEPAKSPPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPHTGISSKAMGIMNSFVNDIFESIAGEASRLAHYNKCSTITSREIQTTVSLLLPGELAKH
AVSKGTKAVTKYTSSR*
218 >lcl|XP_870697.2|Plus11290586..1290966 NW_001493950 histone cluster 1, H2bd-like LOC614206 __SEG__ Chr20 {Bos taurus} MPEPAKSPPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPHTGISSKAMGIMNSFVNDIFESIAGEASRLAHYNKCSTITSREIQTTVSLLLPGELAKH
AVSKGTKAVTKYTSSR*
219 >lcl|XP_870957.2|Plus1complement(143802..144182) NW_001493164 histone cluster 1, H2bc-like LOC614378 __SEG__ Chr13 {Bos taurus} MCEPAKSAPAPKKGYKKAVTKAQKKDGKKRTHSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFEHIAGKALRLVHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
220 >lcl|XP_870957.2|Plus1complement(143802..144182) NW_001493164 histone cluster 1, H2bc-like LOC614378 __SEG__ Chr13 {Bos taurus} MCEPAKSAPAPKKGYKKAVTKAQKKDGKKRTHSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFEHIAGKALRLVHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
221 >lcl|XP_871069.1|Plus11125176..1125568 NW_001494173 histone cluster 1, H2 LOC614970 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
222 >lcl|XP_871069.1|Plus11125176..1125568 NW_001494173 histone cluster 1, H2 LOC614970 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
223 >lcl|XP_871616.1|Plus11926863..1927255 NW_001493541 histone cluster 3, H2a-like LOC614881 __SEG__ Chr17 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLHKGNYTERVGAGAPVYLAAVLEYLTAEILELAGNAARNNKKTRIIPRHLQLAIHNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
224 >lcl|XP_871616.1|Plus11926863..1927255 NW_001493541 histone cluster 3, H2a-like LOC614881 __SEG__ Chr17 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLHKGNYTERVGAGAPVYLAAVLEYLTAEILELAGNAARNNKKTRIIPRHLQLAIHNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
225 >lcl|XP_871733.2|Plus12056181..2056573 NW_001494731 histone cluster 2, H2ab HIST2H2AB __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTESHKPGKNK*
226 >lcl|XP_871733.2|Plus12056181..2056573 NW_001494731 histone cluster 2, H2ab HIST2H2AB __SEG__ Chr3 {Bos taurus} MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKTESHKPGKNK*
227 >lcl|XP_871891.1|Plus12172830..2173210 NW_001494731 histone cluster 1, H2bd-like LOC615091 __SEG__ Chr3 {Bos taurus} MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
228 >lcl|XP_871891.1|Plus12172830..2173210 NW_001494731 histone cluster 1, H2bd-like LOC615091 __SEG__ Chr3 {Bos taurus} MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
229 >lcl|XP_872016.1|Plus11390333..1390701 NW_001493890 histone cluster 1, H2bd-like LOC615183 __SEG__ Chr1 {Bos taurus} MSAEHGQLQQSGGRRGRSPGDKKSRRRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIVNLFVNDLFERLAGKAAWLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSE
GTKAVTKYTSSK*
230 >lcl|XP_872016.1|Plus11390333..1390701 NW_001493890 histone cluster 1, H2bd-like LOC615183 __SEG__ Chr1 {Bos taurus} MSAEHGQLQQSGGRRGRSPGDKKSRRRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIVNLFVNDLFERLAGKAAWLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSE
GTKAVTKYTSSK*
231 >lcl|XP_872589.3|Plus1complement(487719..488219) NW_001508760 histone cluster 1, H2bh-like LOC615633 __SEG__ ChrX {Bos taurus} MGNGGSTMSKPSSDSYEEDVITKENGTSEIEPSETDMAKAETSKPDPYDAEPKKAKQKTAKGRRRRHRHCHHDSFSSFATYFPRVLRQVHTGMSLSHDSVNILDLFVKGM
FEQIAEEAGRLARNNKRRTITHEDIETAVRLLLPGVLSKYSITQATKSLIRYHTCR*
232 >lcl|XP_872589.3|Plus1complement(487719..488219) NW_001508760 histone cluster 1, H2bh-like LOC615633 __SEG__ ChrX {Bos taurus} MGNGGSTMSKPSSDSYEEDVITKENGTSEIEPSETDMAKAETSKPDPYDAEPKKAKQKTAKGRRRRHRHCHHDSFSSFATYFPRVLRQVHTGMSLSHDSVNILDLFVKGM
FEQIAEEAGRLARNNKRRTITHEDIETAVRLLLPGVLSKYSITQATKSLIRYHTCR*
233 >lcl|XP_873430.1|Plus1943116..943643 NW_001493674 histone H1-like protein in spermatids 1-like LOC615867 __SEG__ Chr19 {Bos taurus} MQKDTSLPPPSGPLASNTALGAGRQASSSGLPGKSETRRRTSPNSRRKPSISKVILGFVADKGAGNRVSLAALKKAVATRGYNMTRNAWRFKRVLQGLVDKGMLKQVTGK
GATGSFLMGKNHASKFKLKAKRRRQRRQRQRGQRRPVQRQLLVGSKPGHKRPIKGVRRAAKCRRS*
234 >lcl|XP_873430.1|Plus1943116..943643 NW_001493674 histone H1-like protein in spermatids 1-like LOC615867 __SEG__ Chr19 {Bos taurus} MQKDTSLPPPSGPLASNTALGAGRQASSSGLPGKSETRRRTSPNSRRKPSISKVILGFVADKGAGNRVSLAALKKAVATRGYNMTRNAWRFKRVLQGLVDKGMLKQVTGK
GATGSFLMGKNHASKFKLKAKRRRQRRQRQRGQRRPVQRQLLVGSKPGHKRPIKGVRRAAKCRRS*
235 >lcl|XP_873767.1|Plus1complement(42792..43184) NW_001494179 histone cluster 1, H2ag-like LOC616611 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
236 >lcl|XP_873767.1|Plus1complement(42792..43184) NW_001494179 histone cluster 1, H2ag-like LOC616611 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
237 >lcl|XP_873798.1|Plus1complement(34071..34457) NW_001494179 histone cluster 1, H2ag-like LOC616634 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAK*
238 >lcl|XP_873798.1|Plus1complement(34071..34457) NW_001494179 histone cluster 1, H2ag-like LOC616634 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAK*
239 >lcl|XP_873978.1|Plus1complement(1096579..1096959) NW_001494173 histone cluster 1, H2bd-like LOC616776 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
240 >lcl|XP_873978.1|Plus1complement(1096579..1096959) NW_001494173 histone cluster 1, H2bd-like LOC616776 __SEG__ Chr23 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKH
AVSEGTKAVTKYTSSK*
241 >lcl|XP_874006.1|Plus11099077..1099487 NW_001494173 histone cluster 1, H3f-like LOC616800 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
242 >lcl|XP_874006.1|Plus11099077..1099487 NW_001494173 histone cluster 1, H3f-like LOC616800 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
243 >lcl|XP_874028.1|Plus11109631..1110041 NW_001494173 histone cluster 1, H3f-like LOC616819 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
244 >lcl|XP_874028.1|Plus11109631..1110041 NW_001494173 histone cluster 1, H3f-like LOC616819 __SEG__ Chr23 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
245 >lcl|XP_874074.1|Plus1complement(1140483..1140794) NW_001494173 histone H4 replacement-like LOC527645 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
246 >lcl|XP_874074.1|Plus1complement(1140483..1140794) NW_001494173 histone H4 replacement-like LOC527645 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
247 >lcl|XP_874315.2|Plus11681341..1681721 NW_001493063 histone cluster 1, H2bc-like LOC617043 __SEG__ Chr12 {Bos taurus} MPEPAKSAPAPKQGSKKAVTKAQKKDGKKRKCSRKESYHVYMYKVLKQVHPDTGILSKAMGIMNSFVNAIFEHIAGEASRLAHYNKRSTITSREIQTTLRLLLPGELAKH
AVSEGTKAVTKYTSSK*
248 >lcl|XP_874315.2|Plus11681341..1681721 NW_001493063 histone cluster 1, H2bc-like LOC617043 __SEG__ Chr12 {Bos taurus} MPEPAKSAPAPKQGSKKAVTKAQKKDGKKRKCSRKESYHVYMYKVLKQVHPDTGILSKAMGIMNSFVNAIFEHIAGEASRLAHYNKRSTITSREIQTTLRLLLPGELAKH
AVSEGTKAVTKYTSSK*
249 >lcl|XP_875330.2|Plus1complement(601861..602172) NW_001494179 histone H4 replacement-like LOC617905 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
250 >lcl|XP_875330.2|Plus1complement(601861..602172) NW_001494179 histone H4 replacement-like LOC617905 __SEG__ Chr23 {Bos taurus} MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*
251 >lcl|XP_875437.2|Plus1895928..896308 NW_001493674 histone cluster 1, H2bd-like LOC618012 __SEG__ Chr19 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYMYKELKQVHLDTGLSSKAMGIMNSFINDIFERIGGEASRLAHYNKCSTITSREIQTALRLLLPGELAKH
AVSEGTKAVTKYTSSK*
252 >lcl|XP_875437.2|Plus1895928..896308 NW_001493674 histone cluster 1, H2bd-like LOC618012 __SEG__ Chr19 {Bos taurus} MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYMYKELKQVHLDTGLSSKAMGIMNSFINDIFERIGGEASRLAHYNKCSTITSREIQTALRLLLPGELAKH
AVSEGTKAVTKYTSSK*
253 >lcl|XP_875566.1|Plus1660633..661025 NW_001494179 histone cluster 1, H2ae-like LOC618147 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
254 >lcl|XP_875566.1|Plus1660633..661025 NW_001494179 histone cluster 1, H2ae-like LOC618147 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
255 >lcl|XP_876240.1|Plus1385813..386205 NW_001494179 histone cluster 1, H2ag-like LOC618824 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
256 >lcl|XP_876240.1|Plus1385813..386205 NW_001494179 histone cluster 1, H2ag-like LOC618824 __SEG__ Chr23 {Bos taurus} MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPKKTESHHKAKGK*
257 >lcl|XP_876253.1|Plus1complement(241056..241601) NW_001493823 chromobox homolog 3 CBX3 __SEG__ Chr1 {Bos taurus} MASNKTTLQKMGKKQNGKSKIVEEAEPEEFVVEKVLDHRVVNGKAEYFLKWKGFTDADSIWEPEENLDCPELTEAFNPQKAGKEKDGTKRKSLSDSESHDSKSKKRDAAD
KPRGLVRGLDPERIIGATDGSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ*
258 >lcl|XP_876253.1|Plus1complement(241056..241601) NW_001493823 chromobox homolog 3 CBX3 __SEG__ Chr1 {Bos taurus} MASNKTTLQKMGKKQNGKSKIVEEAEPEEFVVEKVLDHRVVNGKAEYFLKWKGFTDADSIWEPEENLDCPELTEAFNPQKAGKEKDGTKRKSLSDSESHDSKSKKRDAAD
KPRGLVRGLDPERIIGATDGSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ*
259 >lcl|XP_876553.2|Plus1complement(2077606..2078016) NW_001494731 histone cluster 2, H3c2-like LOC619141 __SEG__ Chr3 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
260 >lcl|XP_876553.2|Plus1complement(2077606..2078016) NW_001494731 histone cluster 2, H3c2-like LOC619141 __SEG__ Chr3 {Bos taurus} MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA*
261 >lcl|XP_876701.1|Plus1complement(2102481..2103038) NW_001495460 heterochromatin protein 1-beta isoform 4 LOC506606 __SEG__ Chr8 {Bos taurus} MGKKQNKKKVEEVLEEKEEEYVVEKVLDRRVVKAKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEENKPKKKKEESEKP
RSFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*
262 >lcl|XP_876701.1|Plus1complement(2102481..2103038) NW_001495460 heterochromatin protein 1-beta isoform 4 LOC506606 __SEG__ Chr8 {Bos taurus} MGKKQNKKKVEEVLEEKEEEYVVEKVLDRRVVKAKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEENKPKKKKEESEKP
RSFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN*