SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr A    

ID / Description / Sequence
1 >lcl|XP_001926989.1|Plus1899094..900941 NW_003301277 cleavage stimulation factor subunit 2 tau variant isoform 1 CSTF2T __SEG__ Chr14 {Sus scrofa} MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPI
IDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQPVSGPGPGPGPGPG
LCPGPNVLLNQQNPPAPQPQHLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGPGPGSLTPGGAMQPQVGMPGVGPVPLERGQMQISDPRAPMPRGPMAPGGLPPRGLL
GDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHASGHDSRGPSSHEMRGGPLADPRLLIGEPRGPMIDQRGLPMDGRGSRDSRGMEARAMETEVLETRVMERRGMET
CALETRGMEARGMDARGMEMRGPGPSSRGPMSGGIQGPGPINIGAGGPQGPRQVPSISGVGNPGAGMQGAGMQGASMQGAGMQGAGMQGAGMQGAGMQGAGMQGAGIQGP
GKQGGGQASSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS*
2 >lcl|XP_001929263.1|Plus1418114..418668 NW_003535205 u3 small nucleolar ribonucleoprotein protein IMP3-like LOC100151831 __SEG__ Chr7 {Sus scrofa} MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDPFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRR
LPTVLLKLRMAQHLQAAVTFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA*
3 >lcl|XP_003123185.1|Plus147457..48521 NW_003534271 heterogeneous nuclear ribonucleoproteins A2/B1-like LOC100522063 __SEG__ Chr2 {Sus scrofa} MEKTSKSVPLKKKKRESEQFRKLFIGGLCSETKEESLRNYYQQWGKLTDCVVIRDPSSQRSRGFGFVIFSSVAEVDAAMAARPHSIDGRVVASKRVVPREESGKPGACVT
TKKLFVGGIKEDTTERHLRDYFERYGTIDAIEIIRQSGRKTAFGFVTFDDHDPVDKIVLQKYHTINGHHAQLEKALSRQGMQEVQSSRRRRGRHVGFGDIPSGGGGGGGG
GNFGAGPGRNFRGGSEGYARGPVLGDGYYEYGGGPAGGSFGGCPGYGGGYGDRGAGYSNLSSGFGDGYGNYGGGDYGEGNYNAFGNYNQDPSNYGPVKNGNFGESRHMVA
PYGGGDYGPGGSGGNEGYREARPY*
4 >lcl|XP_003123190.1|Plus1complement(139389..140453) NW_003534271 heterogeneous nuclear ribonucleoproteins A2/B1-like LOC100522980 __SEG__ Chr2 {Sus scrofa} MEKTSKSVPLKKKKRESEQFRKLFIGGLCSETKEESLRNYYQQWGKLTDCVVIRDPSSQRSRGFGFVIFSSVAEVDAAMAARPHSIDGRVVASKRVVPREESGKPGACVT
TKKLFVGGIKEDTTERHLRDYFERYGTIDAIEIIRQSGRKTAFGFVTFDDHDPVDKIVLQKYHTINGHHAQLEKALSRQGMQEVQSSRRGRGRHVGFGDIPSGGGGGGGG
GNFGAGPGRNFRGGSEGYARGPVLGDGYYEYGGGPAGGSFGGCPGYGGGYGDRGAGYSNLSSGFGDGYGNYGGGDYGEGNYNAFGNYNQDPSNYGPVKNGNFGESRHMVA
PYGGGDYGPGGSGGNEGYREARPY*
5 >lcl|XP_003124018.1|Plus1complement(705695..706603) NW_003299617 heterogeneous nuclear ribonucleoprotein A0-like LOC100519826 __SEG__ Chr2 {Sus scrofa} MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVA
EGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIHSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSY
GGYGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF*
6 >lcl|XP_003124320.1|Plus198489..100411 NW_003534395 poly(A) polymerase beta-like LOC100511746 __SEG__ Chr3 {Sus scrofa} MPFPVTTPGCQPPPPPPKRYGISSPISLAPPRETDCVLTQKLIETLKPFGVFEEEEELQRRILILEKLNYLVKEWIRELSESKSLPQAVIENVGGKIFTFGSYRLGVHTK
GADIDALCVAPRHVDRSDFFTSFYDKLKLHEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNF
RLTLRAVKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVS
VSTRMVMIEEFKQGLAITHEILLSKAEWSKLFEAPSFFQKYKHYIALLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPRESPDKEEFRTMWVIG
LVLKRPENSDILSIDLTYDIQSFTDTVYRQAVNSKMFEMDMKIAAMHLRRKELHQLLPNHVLPQKKTPSPEGVRLTALGDGSLGLTADSEDSVSVSSFPGAVKTGPVTGS
SPGRSSPALAMMAAPVISAQVTDVSLQQANPSESPGSASSESIPHAGSLPAILPPKPVVTRVISSTLLVNHPPRPSGSAAANIANPIVGV*
7 >lcl|XP_003125101.2|Plus1<767589..768173 NW_003534488 poly(rC)-binding protein 1-like LOC100526046 __SEG__ Chr3 {Sus scrofa} CLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGTPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWA
SLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS*
8 >lcl|XP_003125105.1|Plus1897012..898082 NW_003534488 poly(rC)-binding protein 1-like LOC100511501 __SEG__ Chr3 {Sus scrofa} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGTPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
9 >lcl|XP_003134119.1|Plus1complement(1981165..1982163) NW_003536572 rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1-like LOC100512568 __SEG__ Chr16 {Sus scrofa} MKSAVSARGGGSGGRGGGGWGGGWGGGRGGGGGGKGAGGNSGGQGGKGGFGARTRGFGGGRGRGRGGGDGRDRGGGGQRRGSGKSKNRRRKGAHVVSVEPHRHEGVFIYR
GAEDALVTLNMVPGQSVYGERRVTVTEGGVKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTNI
IPVLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVKKLQQENLKPQEQLTLEPYERDHAVVVGVYRPLPKSG
SK*
10 >lcl|XP_003134343.1|Plus1710216..710638 NW_003536643 NTF2-related export protein 1-like isoform 1 LOC100514739 __SEG__ Chr17 {Sus scrofa} MASVDFKTYVDQACRAAEEFVNVYYSTMDKRRRLLSRLYTGTATLVWNGNAVSGQESLSEFFEMLPSSEFQINVVDCQPVHDDATPSQTTVLVVICGTVKFEGNKQRDFN
QNFILTAQASPSNAVWKIASDCFRFQDWAC*
11 >lcl|XP_003135023.1|Plus1217163..219055 NW_003536755 probable ATP-dependent RNA helicase DDX53-like LOC100524536 __SEG__ ChrX {Sus scrofa} MAWAPERKRAEPNSRDPRASQHGRDGRGRGRGWSSTSSHVETRASGSREPPLCFKINNSMAGVVIGRGGSKIKDIQGMTNTKIKIIKGDSEAEVKIFGSRDMKAKAKAAI
EALIKNKQGGYNSRSSVGNAASQPSVGRGLSRDNSVREAQPLIDWDQIKAEVVEWEKRKWADLPPIHKNFYVETKATSSMSQVQVDIWRKENFNVMCNDLKDGEKRPIPN
PICKFEDAFGPYPELMKSIKKAGFQKPTPIQSQAWPIVLQGIDLIGIAQTGTGKTLSYLMPGFIHLNSQPVSRGKRNGPGMLVLTPTRELALQVGAECSKYSYKGLKSVC
IYGGGNRKGQIQDIMKGVDIIIATPGRLNDLQMNNFVNLRSITYLVLDEADKMLDLGFEHQIMKILLDVRPDRQTIMTSATWPDTIRQLAHSYLKEPMLVYVGTLDLVAV
DTVKQNIIITTEEEKRSLFQEFLQSLSPKDKVIVFVSRKLIADDLSSDLSIQGIPVQSLHGDREQSDRERALDDFKTGKVKILIATDLASRGLDVSDVTHVFNYNFPRNI
EEYVHRVGRTGRAGKMGESVTLMTQDDWKVAGELIEILQRANQSIPEDLLSMAEQYKLHKQEKETGKKPRTPQEKFREFY*
12 >lcl|XP_003135232.1|Plus1complement(173080..173682) NW_003301802 polyadenylate-binding protein 1-like 2-like LOC100525442 __SEG__ ChrX {Sus scrofa} MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIF
SAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDAMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR*
13 >lcl|XP_003135272.1|Plus125241..26440 NW_003536821 hypothetical protein LOC100511612 LOC100511612 __SEG__ ChrX {Sus scrofa} MDAINFAMNRVDEPQQFPQGFLIKASKNQYDASKMFIGGISRNISKQALLEYLTQFGEILDFIIKTYPDTGLSRGFGFVLFKDSASVEKVLQVEEHKVDGKMIDLKRAKA
MEVKFPPRKVFVGGLNPRMSEEKIREYFGAFGMIENIELPVCPRMNERRAFCFITYTDEKPVRKLLETRYHLIGSGRCEIKIALPKAYVKSQHRGGREFPFARVGNRWGG
IGSQANPNPYMANPNPYMANLNPYVANLNPYVANPNPFGANPNLCRANPSAFGANRNLCRANPDLCGANPSTFGVNPNAFGANPNVCGAVGGDGSPSPVFVPVPFSACNE
GFNFSNQVYGNFHNAYYNDRPVFNTYGGEYFLSYNYGTNAFGTAFTNYNVQMNEASPFNGGYQGLYQPF*
14 >lcl|XP_003135352.1|Plus1332201..332659 NW_003536835 nuclear cap-binding protein subunit 2-like LOC100518288 __SEG__ ChrX {Sus scrofa} MSNDLTIQRSNSCPELSEYQDQQFRGDNEEHEKLLMESSTLYVENLSIYTTEEQIFELFSRCGDVKNVFMGLDNIKKTACGFCFVEYHLRADAENAMRFLNGTLLDDRII
HTKWDIGFKEGRQYAHGRCGGQVRDEFREDANVGGGGFGSQA*
15 >lcl|XP_003353461.1|Plus1868337..868807 NW_003534020 putative RNA-binding protein 3-like LOC100514264 __SEG__ Chr1 {Sus scrofa} MSSEEGKLFVGGLNFNSDKQALEDHISSFRPISEVVIVKDRETQRSRGFGFITFTNPEHASNVMRAMNGESLDGRQIHVDHAGKSAQGTRRGAFGARGRGYSRGGGEQGS
GNGRYDSRPGGYVYGYGYGKSRDYGSRSQGSYDSYSGGNCRDNYDN*
16 >lcl|XP_003355824.1|Plus1complement(103489..105111) NW_003534916 probable ATP-dependent RNA helicase DDX28-like LOC100621490 __SEG__ Chr6 {Sus scrofa} MALARQLRLLSLVTRLHLAPRRDLTVRGPDEPLPVVRIPRALQRRQEQRQRGQQGPPRPVLVRPGQLLISARRPELNQPARLTLGRWEPAPLASRGWKNRRARQDHFSIE
RKQQEAPALRNLSSKDSFADLGLEPRVLSALQEAAPEVVRPTTVQSSTIPPLLGGRHILCAAETGSGKTLGYMLPLLQRLLGQPSLDSCRIPAPRGLVLVPSRELAEQVR
AVAQPLGSSLGLQVRELGGGHGMSRIRLQLSKQPPADVLVATPGALWKGLKSQLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLKDPFNPKAQLVLVG
ATFPEGVSQLLSKAACLDSLTTITSSKLHCIMPHVKQTFMRLKGAEKVTELVQILKQHDRAYRTGSAGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPASMRAGIF
QSFQRGSQDILLCTDIASRGLDSTQVELVINYDFPLTLQDYIHRAGRVGRVGSKVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLGSSVREPLPQQT*
17 >lcl|XP_003357073.1|Plus181204..82316 NW_003535417 polyadenylate-binding protein 4-like LOC100627820 __SEG__ Chr8 {Sus scrofa} MNIAAKYRQASLYVGDLHADVTEDLLFKKFSTVGPVLSIRICRDLVTRRSLGYAYVNFLQLADAQKALDTMNFDLIKGKSIRLMWSQRDAYLRKSGIGNVFIKNLDKSID
NKTLYEHFSAFGKILSSKVMSDDQGSRGYAFVHFQNQIAADRAIEEMNGALLKDCRLFVGRFKNRKDREAELQNKANEFTNVYIKNFGDDMDDERLKEVFSKYGKTLSVK
VMRDSSGKSKGFGFVSFDSHEAAKKAVEEMNGKDINGQLLFVGRAQKKAERQAELKQMFEQLKRERFRRCQGVKLYIKNLDETIDDEKLRREFSSFGSISRVKVMQEEGR
SKGFGLICFSSPEEATKAMTEMNGRILGSKPLNIALAQKP*
18 >lcl|XP_003357791.1|Plus1complement(73312..74169) NW_003535702 ribonuclease P protein subunit p38-like isoform 1 LOC100626611 __SEG__ Chr10 {Sus scrofa} MAAAPQAPGRGSVRKTRPPPVKTSLNNPYATCWGTLGQEDMHFILQTLEVRFKSLGLRKVEDRKRKKKQPSLGKESGDTCGMAADTGQDLEEKRSEGDAQASGWTPAHVR
KQLAIGVNEVTRALERNELLLVLACKSAKPAMVTAHLVQLSASRGVPAGQVPRLSERIAPVVGLKCILALGFRKNTTAFADEVSTIIPRVPPLNVPWLGDLQDTPEDPQE
NSETKSLESRDKEILETSFEDLSKPKRKLAEGQQAVVLQPLKIKKLIPNPNKIRKPPKSKKMASK*
19 >lcl|XP_003359102.1|Plus1complement(904105..904608) NW_001885400 PIN2/TERF1-interacting telomerase inhibitor 1 LOC100154593 __SEG__ Chr14 {Sus scrofa} MCNGFSLFSTPQETSSPATPEGTETTTTTSAFTIHEYFAKRMAERKNKLQDTAEGPGVSETPLQSKRGKKRKKEAKDKSVENGTQPKAKKKRARAEWQLGDPGRDENSGV
SAEDREGSREVLSDQDFPLKPRRRKEKKKLPKPVEAAVAGMLEETPVKKKKKKKDSE*
20 >lcl|XP_003359137.1|Plus1complement(625705..626445) NW_003536210 u11/U12 small nuclear ribonucleoprotein 35 kDa protein-like isoform 1 LOC100626152 __SEG__ Chr14 {Sus scrofa} MNDWVPIAKEYDPLKAGSIDGTDEDPHDRAIWRAMLARYTPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERSLLKAYR
DADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRQPINLPVVKNDQFREGKRERRERSRSRERHWDSRMRDRGHDRGRDKRWQEREPARVW
PEGDWERERDFRDDRVKGREKRDRSK*
21 >lcl|XP_003359253.1|Plus1complement(1002673..1003917) NW_003536238 heterogeneous nuclear ribonucleoprotein F HNRNPF __SEG__ Chr14 {Sus scrofa} MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIRDGAAGVHFIYTREGRQSGEAFVELESEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADTAND
GFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLERMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDGEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHDEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQMMQGMGVSTQSTYSGLESQSVSGCYGAGYGGQNSMGGYD*
22 >lcl|XP_003359533.1|Plus1<172..342 NW_003536401 u6 snRNA-associated Sm-like protein LSm1-like LOC100626765 __SEG__ Chr15 {Sus scrofa} DLEKESDTPLQQVSIEEILEEQRVEQQARLEAEKLKVQALKDRGLSIPRADTLDEY*
23 >lcl|XP_003359964.1|Plus1709946..710638 NW_003536643 NTF2-related export protein 1-like isoform 2 LOC100514739 __SEG__ Chr17 {Sus scrofa} MCGSQAFSVSVRCTLLCLFLHSVTHSNFKTSKLRRSKTRHRHQCLLESSPPYVFVLPPAEDAGTHTGSLRLSCPTAWLPQEQEAPGRRPEMASVDFKTYVDQACRAAEEF
VNVYYSTMDKRRRLLSRLYTGTATLVWNGNAVSGQESLSEFFEMLPSSEFQINVVDCQPVHDDATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQASPSNAVWKIAS
DCFRFQDWAC*
24 >lcl|XP_003360021.1|Plus1complement(590764..591543) NW_003301648 uncharacterized protein C20orf4 homolog LOC100625265 __SEG__ Chr17 {Sus scrofa} MATMQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPREMGPRMGFFLSLQQRGLMVLRWNAVREEVDLSPAPEAEVEA
MRANLQELDQFLGPYPYATLKKWISLTSFISETTVEKLQPESRHICAFSEVLPVLSMKHTKDRVGQNLPRCGTECKSYQEGLARLPEMKPRAGTEIRFSELPTQMFPAGA
TPAEITRHSMDLSYALETVLSKHFPNSPQDVLGEEEQAL*
25 >lcl|XP_003360416.1|Plus1151280..151882 NW_003301802 polyadenylate-binding protein 1-like 2-like LOC100623240 __SEG__ ChrX {Sus scrofa} MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIF
SAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDAMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR*
26 >lcl|XP_003360438.1|Plus1complement(1037687..1038073) NW_003536825 NHP2-like protein 1-like LOC100155098 __SEG__ ChrX {Sus scrofa} MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKKGS
QLKQQIQSIQPSIQRLLV*
27 >lcl|XP_003360532.1|Plus1319509..319895 NW_001886700 NHP2-like protein 1-like LOC100152658 __SEG__ ChrX {Sus scrofa} MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISVFIVTAADAEPLEIILHLPLLCEDKNGPYVFVRSKQALGRACGVSRPVIACSVTIREGS
QLKQQIQSIQQSIERLLV*