SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor A    

ID / Description / Sequence
1 >lcl|NP_001012020.1|Plus1422767..424695 NW_047369 poly(A) polymerase beta (testis specific) Papolb __SEG__ Chr12 {Rattus norvegicus} MMPFAVTTQGAQQPAPAPKQYGISSPISLAAPKDTDRELTQKLIETLQPFGVFEEEEELQRRILILQKLNNLVKEWIREISESRNLPQAVIENVGGKIFTFGSYRLGVHT
KGADIDALCVAPRHVDRNDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDS
FRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
SVSTRMVMIEEFKQGLAITHEILLNKAEWSKLFEAPSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENVDKEEFRTMWVI
GLVLKKPENSEILSIDLTYDIQSFTDTVYRQAINSKMFEMDMKIAAMHLRRKELHQLLPNHVLQKKETHLTEGVRLTAVNDSSLLLSIDSENSMTAPSPTGTIKTGPLTA
NPQGRNSPALAVMAASVTNIQFPDVSLQHVNPIESSGIALSESIAQIPSQPTISPPPKPTMTRVVSSTHLVNHPSRPSGNTATNIPNPILGV*
2 >lcl|NP_001014041.1|Plus1488761..490110 NW_048044 heterogeneous nuclear ribonucleoprotein H2 Hnrnph2 __SEG__ ChrX {Rattus norvegicus} MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTAND
GFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYN
SIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGE
ADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSAGYGGGYGGQSSMSGYDQVLQEN
SSDYQSNLA*
3 >lcl|NP_001014149.1|Plus1complement(4658714..4659448) NW_047375 U11/U12 snRNP 35K U1snrnpbp __SEG__ Chr12 {Rattus norvegicus} MSDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERALLKAYR
DADGLVIDQHEIFVDYELERTLRGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNEPHREGKRERRERSRSRDRHWDPRPRERDHDRGREKHWQDRARVWPE
NDWEREREFRDERAKTRDKRDRSK*
4 >lcl|NP_001017504.1|Plus120687155..20688441 NW_047430 zinc finger (CCCH type), RNA binding motif and serine/arginine rich 1 Zrsr1 __SEG__ Chr14 {Rattus norvegicus} MASQQTAFPEKLSRKQYKAAMKKEKRKKRRQKMARLRALEAPPEVEEEDVSANEELAERLLEIERQKLHEEWLLREEKAQEEFRIKKKKEEAARKQKEEQERQIKAEWEE
QQKKQREEEEQKLQEKKEREEAVQKMLDQAENEGTWQNPEPPKDLRLEKYRPSCPFYNKTGACRFGNRCSRKHDFPTSSPTLLVKSMFTTFGMEQCRRDDYDSDANLEYS
EEETYQQFLDFYHDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKVAICGLFEMQKCPKGKHCNFLHVFRNPNNE
FRDANRDIYLPPASTGSSGKNSDRGDRKDHREESYSKSRSHHSGSYHSSKRSRESERKSPHRWKKSHKQATKSHERHSSRRGREEGSSPGPQSQSHRT*
5 >lcl|NP_001028235.1|Plus11466116..1466934 NW_047496 ribonuclease P/MRP 38 subunit Rpp38 __SEG__ Chr17 {Rattus norvegicus} MAAAPQAPKRGSIRKTRPLVVKTSLNNPYVISWSSLEREDMHFILQTLEDKFKSIGLQKIEDKKKRKAKQRGGLVGTSEEPQEPHGGVRVSGWTPVHTRKQLAIGVNEVT
RALERNELLLVLVCKSVKPAIITSHLIQLSLSRTVPACQVPQLSERIAPVIGLKCVLALGFRKNTMDFADEVEAIIPRVPSLNVPWLPDGTQGLTDSLETESLESQDKEV
LDTSFDDLTRLKRKLAEGGQAPAATLQPLKIKRLVPNPSKIRKPPKSKNPSK*
6 >lcl|NP_001032362.1|Plus17330306..7331553 NW_047696 heterogeneous nuclear ribonucleoprotein F Hnrnpf __SEG__ Chr4 {Rattus norvegicus} MMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSAND
GFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLDRMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD*
7 >lcl|NP_001096831.1|Plus1complement(10620210..10621259) NW_047773 tRNA-specific adenosine deaminase-like protein 3 Adat3 __SEG__ Chr7 {Rattus norvegicus} MEPTSGFAEQPGPEKVESEEQEPAQWQALPVLSEQQSGAVELVLAYAAPVLDKRQTSRLLREVSAVYPLPAQPHLKRVRPSRSAGGAHSSDLLLCLAGPSAGPRSLAELL
PRPAVDPRGLGTPFLVPVPARPPLTRSQFEEARAHWPTSFHEDKQVTSALAGQLFSAQARAAMQTHMERAVRAAQRAAAQGLRAVGAVVVDPASDHVLATGHDCCSEASP
LLHAVMVCIDLVAQGQGRGSCDLRRHPACSFTQATATQSARAGSVRKLDEDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGALGTRFRVHARPDLNHR
FQVFRGILEDQCRQLDPDP*
8 >lcl|NP_001099621.1|Plus11424851..1426743 NW_047512 poly(A) binding protein, cytoplasmic 2 Pabpc2 __SEG__ Chr18 {Rattus norvegicus} MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRDVITRRSLGYASVNFEQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIKNLNKTI
DNKALYDTFSAFGNILSCKVVCDENGSKGHGFVHFETEEAAERAIEKMNGMLLNDRKVFVGQFKSRKEREAELGTRTKEFTNVYIKNFGDRMDDKTLNGLFGRFGQVLSV
KVMTDEGGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGPAQKKVDRHIELKRKFEQVTQDRGIRYQGINLYVKNLDDGIDDERLQKEFSPFGTITSTKVMTEGG
RSKGFGFVCFSSPEEATKAVSEMNGRIVATKPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNSLINAYQPAPSGYSVAAVPQTQNCAPCCPSQIVQPSPSTRWTAQGA
RPHPFPNVSGASHPAAPKSSFTTVRPSSSHVPQVMAAQRITNTSAQTTGQRPALASSPATTPVRSIPQYKYATGVRNSQQHLNAQLVQQPSVCIQGQEPWTASTLGTAPQ
EQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSEPLHMLDSPESLCSRAQEAVSALQAHQANEAAQKAAGSTSGVPTV*
9 >lcl|NP_001099656.1|Plus12541625..2543928 NW_047536 FtsJ methyltransferase domain containing 1 Ftsjd1 __SEG__ Chr19 {Rattus norvegicus} MSKRRKRPAQQPASPETFSPDALNAVSELFAKNFSYCKPLDHEWQLPAPAESFTCEHVEFQAFLDLKNSLNAVKNLLCDKELDGWHRHTAFTNRAGQIIAHVRKAVNAEL
CTQAWCKFQEILCSFPLIPQEAFQSGRLNSLHLCEAPGAFIASLNHYLKSHRFPCEWSWVANSLNPYHEANDNLRMITDDRLIANTLHRWYFGPDNTGDIMTLKYLTGLQ
DFLSGTSPIHLVTADGSFDCQGNPGEQEALVSPLHYCEAVTALTTLGDGGSFVLKMFTLFEHCSVNLMYLLNCSFDQVHVFKPATSKAGNSEVYVVCLCYKGREAIRPLL
SRMVLNFGTEMTKKALFPHHVIPKSFLERHRECCTLFHRYQLETISENIRLFECMGTGEQEKLNNLRNCAVQHFMQKFQLKPLSRNHWLVKKSTLGCSTNTKWFGQRNKY
FRTYNERKMLETLSWKDKVARGFFDSWAEEHVVYHPGQSPLLEGSASSLECHLWCILEGKKLPKVKCSPFCDSEILKTLNEAIEKSSGEALSVESKVSPKQQYRCCQIFS
EESVLSELLSLTKCLQEEQGVEPSNPIRCLLVGSPTVRDLQMYTALEVQLLESVELTAFSCSLLHDGDPAYQHLFLNCLLHSLKQLHSGDVMILPILSCFTRFMAGLTFV
LHSCFRFITFSCPTSSEPLRTCAVLLCIGYQNLPDPVFQFLQNVNELLGTLLHPGAPQQVLQFVPMEVLLQGTLLDFLWDLNAAIAKRHLHLIIQGERDKVISSLEL*
10 >lcl|NP_001099899.1|Plus1complement(20515896..20517008) NW_047625 poly(A) binding protein, cytoplasmic 4-like Pabpc4l __SEG__ Chr2 {Rattus norvegicus} MSVETKYRAASLYVGDLHEDVTEDLLFRKFNTVGPVLSIRICRDLISHRSLGYGYVNFLQVGDAQKALETMNFDLIKGKSIRLMWSQRDACLRKSGIGNVFIKNLDKSID
NKTLYEHFSPFGKIMSSKVMTDEEGSKGYGFVHYQDQRAADRAIEEMNGKLLRDSTLFVARFKSRKDREAELREKPAEFTNVYIKNFGDDMDDESLRSVFSKYGQTLSVK
VMKDASGKSKRFGFVSFDSHKAAKNAVEDMNGRDINGQTIFVGRAQKKVERQAELKEMFEQMKKERIRARQAAKLYIKNLDDTIDDETLRKEFSVFGSICRVKVMQEAGQ
SKGFGLICFFSPEAAAKAMAEMNGRILGSKPLNIALGQKH*
11 >lcl|NP_001099991.1|Plus127584541..27584963 NW_047658 NTF2-like export factor 1 Nxt1 __SEG__ Chr3 {Rattus norvegicus} MASVDFKTYVDQACRAAEEFVNVYYTTMDNRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFN
QNFILTAQASPSNTVWKIASDCFRFQDWAS*
12 >lcl|NP_001101056.1|Plus13243643..3245532 NW_047565 cleavage stimulation factor, 3' pre-RNA subunit 2, tau Cstf2t __SEG__ Chr1 {Rattus norvegicus} MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPI
IDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQPVSGPGPGGPGGPG
GPGGPGPGPAPGLCPGPNVMLNQQNPAPQPQHLPRRPVKDIPPLMQTSIQGGIPAPGPIPAAVPGPGPGSLTPGGTMQPQVGMPVVGPVPLERGQMQISDPRPPMPRGPM
PSGGIPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYMGPPHQGPPMHHGHDNRGPASHDMRGGPLAADPRMLIGEPRGPMMDQRGLPMDGRGGRDSRGMEARPMETEVLEP
RGMERRMETCAMETRGMEARGIDARGLEMRGPGPSSRGPMTGGIQGPGPINMGAGGPQGPRQVPNIAGVGNPGGAMQGAGIQGAGMQGAGMQGGGMQGAGMQGGGMQGAG
MQGGGMQGAGMQGASKQGAGQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS*
13 >lcl|NP_001101622.1|Plus130304622..30305176 NW_047799 IMP3, U3 small nucleolar ribonucleoprotein, homolog Imp3 __SEG__ Chr8 {Rattus norvegicus} MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYGLQRREEYTRYNQLSRAVRELARRLRDLPERDPFRVRASAALLDKLYALGLVPTRGSLELCDSVSASSFCRRR
LPTLLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLDA*
14 >lcl|NP_001102294.1|Plus1complement(7533236..7534210) NW_047334 fibrillarin-like 1 Fbll1 __SEG__ Chr10 {Rattus norvegicus} MKPAGGRGGWSWGGGKGGGKGGDTGSGAKGGFGTRTRGGGGGGRGRGRGGGGGGGGGGGGGGGGGGGDRQRRGGPGRNKNRRKKGITVSVEPHRHEGVFIYRGAEDALVT
LNMVPGVSVYGEKRVTVTENGEKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTNIIPVLEDAR
HPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVKKLQQENLKPQEQLTLEPYERDHAVVVGVYRPAPKSSSK*
15 >lcl|NP_001102328.1|Plus17924305..7926284 NW_047400 hypothetical protein LOC364073 RGD1309586 __SEG__ Chr13 {Rattus norvegicus} MSHVAEEDELGLDQQLAGLDLTSPDSQSGASTASKGRYIPPHLRNREATKASYDKDSSRWSKDKDAYSSFGSRSDTRAKSSFFSDRGSGSRGRFDDRGRSDYEGVGSRGG
RSGFGKFERGGNSRWCDKADEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMA
CAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMME
RGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEADKRSFLLDLLNATGKDS
LILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINI
TKDLLDLLVEAKQEVPSWLENMAFEHHYKGGSRGRSKSRFSGGFGARDYRQSSGASSSSFSSGRASNSRSGGGSHGSSRGFGGGSYGGFYNSDGYGGNYSSQGVDWWGN*
16 >lcl|NP_001102363.1|Plus112845253..12845654 NW_047531 hypothetical protein LOC364946 RGD1559772 __SEG__ Chr19 {Rattus norvegicus} MDHLESFTRVCDWRTKLAKKGLAETQEETSSEVSAKAEKVHELNEEIGKLLAKAEQLRAEGNMDESQKILMEVEKVCAKKKEAEKEYRNSIHFSNSKNSVSSRFVQLILV
SHSNGHHLAGHFGAKFHLGFIQI*
17 >lcl|NP_001102368.1|Plus1complement(7422875..7424497) NW_047535 DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 Ddx28 __SEG__ Chr19 {Rattus norvegicus} MALAGPTRLLSLAVRLLLEPRRNIVLRGSDQSLPVVRIPRALQRRQEQRRSDRGSFQRPVLVQPGPLLVSAKRPELNQPARLTLGRWERAPLASRGWKHRRSRQDHFSIE
RVQQEAPAMRNLSSRGNFVDLGLEPRVLLALQKAVPEIVQPTSVQSKTIPPLLRGRHILCAAETGSGKTLSYLLPLFQRLLKGPELDSRSSTAPRGLVLVPSRELAEQVQ
AVAQSLGRYLDLQVIELGGGLGMNRLKLQLGKWPSADVLVATPGALWKALKSQLISLHHLNFIVLDEVDTLLDESFVELVDYILGKSPIAESPAELEDPFNPKAQLVMVG
ATFPEGLNQLLSKVTSPDSLTTITSSKLHCIMPHVRQTFMRLKGTEKVTELIQILKQHDKANKAEPSGTVLVFCNSASTVNWLGYILDDHKIQHLRLQGQMPASMRAGIF
QSFQKGSQNILVCTDIASRGLDSIHVEMVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVTSFVTHPWDVSLVQKIELAARRRRSLPGLTSSVRDPLPQQD*
18 >lcl|NP_001102446.1|Plus16609371..6609739 NW_047719 LSM10, U7 small nuclear RNA associated Lsm10 __SEG__ Chr5 {Rattus norvegicus} MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFMNIRLANVTYTDRWGHQVELDDLFVTGRNVRYVHIPDGVNITATIEQQLQIIHRVRNFGGK
GQGRREFPSKRP*
19 >lcl|NP_001103836.1|Plus120916410..20917558 NW_048043 poly A binding protein, cytoplasmic 5 Pabpc5 __SEG__ ChrX {Rattus norvegicus} MGSGEPNTAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDHLRKSGVGNIFI
KNLDKSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNFGDDIDDEKLKKLFS
EYGPTESVKVIRDATGKSKGFGFVRYETHEAAQKAVLELHGKSIDGKVLCVGRAQKKIERLAELRRRFERLKLKDKTRPPGVPIYIKNLDETINDEKLKEEFSLFGSISR
AKVMMEVGQGKGFGVVCFSSFEEASKAVNEMNGRVVGSKTLHVTLGQARHRW*
20 >lcl|NP_877970.1|Plus1complement(673697..675463) NW_048036 polypyrimidine tract-binding protein Smptb __SEG__ ChrX {Rattus norvegicus} MSRNSPPAAEGNGSKRFKGDSWGTRDPSRLVHILRLPSCVTEGEILCLALPFGEVSNLLFLRAKNQAFVEMSTEESANTMINYYTWMPPVLRGQPVHIQFAHYRELKVSS
SPSQEISLSQAGDSREATASSLVAVPGQAAASGQTAVPSQLGAQPCLPPEDSYQAGTVALAPPASAVDTELVVAWQSPVLRILVENYFYRVTLEVLHQIFSRFGTVLKII
TCTKNNRFQALLQYAHVMSAERAKLFLDGQNIYDACCTLRISFSGLTNLMVKYNNDKSRDYMRPDLPSDDSQPSPVQVQNMASALPAPAMSSASPYASIALPHTFAIPQA
AGLANPEVFKTLHPQAIQEVAMASSSSSSSTAAAAVGAAEIAAAAVPGAEGSMVTSGSPGVGSPVLLVANLNQEKVTPRSLFILFGAYGDVHRVKILFNRKENALVQMAD
GSQAELALRHLNGHKLYGKALCILLSKHQSVKLPREGKEDQGLTKDYANSPLHRFKKPGSKNFQNIFPPSATLHLSNLPSLVSEEELKNLFSSNGYAVKAFRFFPKNHKM
ALIRMGSTEEAIQALVDLHGHLLGQNHHMRVSFSRMTI*
21 >lcl|XP_001054331.1|Plus11374435..1374707 NW_047469 LSM5 homolog, U6 small nuclear RNA associated LOC679753 __SEG__ Chr16 {Rattus norvegicus} MAVNATTNRSQLLPLELVAKCIGSRIHIVMKSDKDIVGTPLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGEGPEV*
22 >lcl|XP_001057009.1|Plus13510970..3511200 NW_048043 small nuclear ribonucleoprotein polypeptide G-like LOC680394 __SEG__ ChrX {Rattus norvegicus} MSKAHPPELKKFMDKKLSLKLNGGRHVQGILQGFDPFMSLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
23 >lcl|XP_001058361.1|Plus15260489..5261697 NW_047696 Sjogren syndrome antigen B LOC680385 __SEG__ Chr4 {Rattus norvegicus} MAENGDNEKMAALEAKICHQIEYYFGDFNLPQDKFLKEQIKLDEGWVSLETMIKFNRLNRLTTDFNVIVQALSKSKAKLMEVSADKTKIRRSPSRPLPEVMDEYKNDVKN
RSVYIKGFPTDATLDDIKEWLDDKGQILNIQMRRKLHKTFKGSIFAVFDSIQSAKKFVDTPGQKYKDTNLLILFKEDYFAKKNEERKQSKVEAKLKAKQEHEGRHKPGST
ETRALEGKMGCLLKFSGDLDDQTCREDLHFLFSNHGEIKWIDFVRGAKEGIILFKEKAKDTLEKARSANNGNLLLRNKKMTWKVLEGHAEKDAMKKITDDQQESLNKWKS
KGGHVRRFKGRGKGNRPAYAGAPKGRGQFQGRRTRFDDDDHRRGPMKRGRDGRDREEPASEHKKRENGARDK*
24 >lcl|XP_001063116.2|Plus1complement(1243545..1244024) NW_047334 U1 small nuclear ribonucleoprotein 1C LOC685273 __SEG__ Chr10 {Rattus norvegicus} MPKFYCDYCDTYLTHDSPSVRKTHCNGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPAPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPP
PGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR*
25 >lcl|XP_001063547.1|Plus1complement(5786407..5786637) NW_047556 small nuclear ribonucleoprotein polypeptide G-like LOC685376 __SEG__ Chr1 {Rattus norvegicus} MSEGHPPERRKVMDGKLSLKLDGGRRVRGVLRGFDPFMNLVVDECVEMGNSGQQNNSGVVVIRGNSIVMLEALERA*
26 >lcl|XP_001064438.1|Plus1complement(3756177..3756455) NW_047803 small nuclear ribonucleoprotein polypeptide E-like Snrpe __SEG__ Chr8 {Rattus norvegicus} MAYLGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN*
27 >lcl|XP_001070496.1|Plus19337240..9337641 NW_047397 hypothetical protein LOC689352 __SEG__ Chr13 {Rattus norvegicus} MGREIKKVVGVEKDRERGKIRRRRRRRRKDKKKEKKNKNKKNKKKNKKKMKKEKEEEEKEKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRRREEEEKKEKKDLEQKQE
QGLEQKEEQEKERIRTKEQDMIK*
28 >lcl|XP_001074288.2|Plus19811901..9812227 NW_047536 LSM7 homolog, U6 small nuclear RNA associated-like LOC690350 __SEG__ Chr19 {Rattus norvegicus} MCGDKMADKGKKKKESILDLPKYIDKTIRVKFQGGWEASGISKGFDSLLNLVLDGTIEYRRDPDDQHKLTEDARQLGLIVCPGTSVVLICPQDAMEALPNPFVQQQDT*
29 >lcl|XP_001075060.1|Plus1complement(2004303..2004533) NW_047627 small nuclear ribonucleoprotein polypeptide G-like Snrpgl2 __SEG__ Chr2 {Rattus norvegicus} MSKAHPPELKKFMDKKLSLKLNGTRRVQGILRGFDPFTNLVIDECVEMVTSGQQNNIGTVVIRGNSIIMLETLERV*
30 >lcl|XP_002728036.1|Plus1complement(17547023..17547421) NW_047390 heterogeneous nuclear ribonucleoprotein A1-like LOC100361905 __SEG__ Chr13 {Rattus norvegicus} MCKSESPKEPKLLQKLFIGGLSFETTYKNRRSHFEQRGTLTDCVVRRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDARVVEPNRAVSREDSQRPGAHLTVKKVLYV
VLKKTLKNITYKIIMSNMGKLK*
31 >lcl|XP_002728078.1|Plus1complement(310944..311138) NW_047399 H/ACA ribonucleoprotein complex subunit 3 LOC100360065 __SEG__ Chr13 {Rattus norvegicus} MFLQYYLNEQGDHVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKCFKVLMTQQPRPVL*
32 >lcl|XP_002728170.1|Plus1849442..849672 NW_047430 small nuclear ribonucleoprotein polypeptide G-like LOC100360635 __SEG__ Chr14 {Rattus norvegicus} MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
33 >lcl|XP_002728437.1|Plus1724554..724868 NW_047470 CCR4-NOT transcription complex, subunit 7-like LOC100361786 __SEG__ Chr16 {Rattus norvegicus} MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLT*
34 >lcl|XP_002728556.1|Plus1complement(32041090..32041812) NW_047492 rCG55925-like RGD1564416 __SEG__ Chr17 {Rattus norvegicus} MENTSNFLVMRDPNTKRSRGFGFVPYTTVEEVDATMNARPHKVGGRVVGPKRVSCGMEKSQRPGAPLTMKKVLVGGINEDTEEHHLRDYFEWYGKTEVIEIMTDRGSVKK
RGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQERASASSSQRGRSGSGNFGGGRGGGFGSNDNFGSGGNFCGHGDFGGSHGGGGYGGRGMAIMDLAMMEAILE
VVETTMILTMITIGLRILDR*
35 >lcl|XP_002728648.1|Plus16959120..6959455 NW_047535 small nuclear ribonucleoprotein E-like LOC100361838 __SEG__ Chr19 {Rattus norvegicus} MRHLNSGPLPIRVVFVTSTMAYCSQGQKVQKVMVQPSSLIIRYLQNRSRIQVWLYEQVNMWIEGCIIGFDEYMNLVLDDTEEIHSKTKSGKQLGQIMLKGDNIALLQSVS
N*
36 >lcl|XP_002728681.1|Plus1544019..>544258 NW_047545 hypothetical protein LOC100362621 __SEG__ Chr1 {Rattus norvegicus} MLYFRKTIPLLIYYHQREGGKKKKKKKKKKKKKKKKKKKKKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEGEGE
37 >lcl|XP_002728760.1|Plus1complement(3213479..3215179) NW_047556 hypothetical protein LOC100363433 __SEG__ Chr1 {Rattus norvegicus} MHSPSKRSSKRSMAPASTGPSKPTAAPTAPAAPTAPASTGPSKPTPAPAAPMVSTSPVSLKNTKAAVPNSSSVHPKSPNLLMSPSSSKSTRPIGNKTVPSTRPSSRSQGR
SKTRTSSQVSTDTKARKGSRGRKGGKTGVMGPYKQRDTHSRGRTPGKRVSQSSKTSPNRASTPNRKRTHSAKPGVAKKARTPTSHRKQSRGKSYSRPRTSAHEKSDNWLR
NRHRTKSPKLHGALDTKDTAISSRAKSYSPSRTVFKSFSKSPVVSRRARSYSQVMSPSREQIHTITDLTHMAGMTKSYKQARSHSRTHSLSRSRTPSRTRSHSRSRTPRR
SRSHSHKRTRSQERSYSWKKNRGRARSRTRRGTPTQVRQSQGSNHSPGKPPRRERSQVWSRSSSEEKGNSRSKSTKVRRDHSRSRTTRKKGHRRSRMSSPESESSQSRSP
GADTAHSRSRTSIKKRARSRSRISSTENHRDRSRTHSRERALSQSRTPSKDKEPTQDATPPILHGDPSPTRTETSSQKRADSEANGHPSTELPKEIRTQDDSIVNTAISK
ATSPGERSSSSSSKLA*
38 >lcl|XP_002728814.1|Plus1complement(15892679..15892957) NW_047560 small nuclear ribonucleoprotein polypeptide E-like LOC100362099 __SEG__ Chr1 {Rattus norvegicus} MEYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMQIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN*
39 >lcl|XP_002729065.1|Plus1complement(19850635..19850826) NW_047623 thioredoxin-like 4 LOC100363110 __SEG__ Chr2 {Rattus norvegicus} MYYILPHLHNGWQVDQAILSEEDCVVVIHFRHDWGPTCMKMDEVLYIIAETKWKIVRDCPHLV*
40 >lcl|XP_002729230.1|Plus1complement(8127819..8128010) NW_047657 H/ACA ribonucleoprotein complex subunit 3 LOC100363269 __SEG__ Chr3 {Rattus norvegicus} MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHSARFSTDDKYSKHRITIKKSFKVLMTQQPRAC*
41 >lcl|XP_002729522.1|Plus1complement(1008592..1009983) NW_047712 heterogeneous nuclear ribonucleoprotein K LOC100359916 __SEG__ Chr5 {Rattus norvegicus} METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEE
GLQLPSPAATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKG
RAQPYDPNFYDETYDYGGFTMLFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGWPG
DRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDWIITITGT
QDQIQNAQYLLQNSVKQYSGKFF*
42 >lcl|XP_002729799.1|Plus1734466..734654 NW_047773 thioredoxin-like 4-like LOC100360662 __SEG__ Chr7 {Rattus norvegicus} MSMLLHLHNGWQVDQAIHSEEDCVVVIHFGHDWDPTCMKIYKVLYRIAETKWKIVRDLPHPV*
43 >lcl|XP_002729879.1|Plus113829125..13829586 NW_047780 CG3918-like LOC100362980 __SEG__ Chr7 {Rattus norvegicus} MAVPGCNKDNVQAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEESEELNKLQALQEKRINEEEEKKKEKSREKIKLKKKRKRSNSSTTEEDSSKQKKQK
YQKKEKKKEKKNKSKKGKHHKKEKKKRKKEKRSSPNRSEVTKK*
44 >lcl|XP_002729911.1|Plus1complement(2406423..2406704) NW_047797 rCG64127-like LOC689185 __SEG__ Chr8 {Rattus norvegicus} MSFKTTNENLRSHFEQWRTLTNCMVMRDPNTKRYRDFGIVTYATVEEVGGAMNARPHKIDGRVVEPKRGVSRAQKPGDHLTVKIFLLVVLKKH*
45 >lcl|XP_002729912.1|Plus1complement(2580923..2581204) NW_047797 rCG64127-like LOC689196 __SEG__ Chr8 {Rattus norvegicus} MSFKTTNENLRSHFEQWRTLTNCMVMRDPNTKRYRDFGIVTYATVEEVGGAMNARPHKIDGRVVEPKRGVSRAQKPGDHLTVKIFLLVVLKKH*
46 >lcl|XP_229073.1|Plus1complement(26448033..26449730) NW_048043 heterogeneous nuclear ribonucleoprotein D-like Rbm31y __SEG__ ChrX {Rattus norvegicus} MNTASLAVRKYNERDQLREGFRIDATKNQQDASKMFIGGLSQELNKQVLLEYLSKFGEIIDFIIKIDPNTGLSRGFGFVLFKDSSTVEKVLRVKDHKVDGKKIEFKRAKA
LESQFPIKKVFVGGLNPRMSEEKIRAYFGTFGQIEAIELPLCSDTQERRAFGFIKYMDENPVRKVLETRYHFIGSSRCEVKMAFPKEYPARQLSKSKTRAKDRARTAVPA
AELENHWRGGGSQNFHIMDNSDTQEANQDAHRAGSYTSRANSDVTLSNARGFRDTPNAFQANPNVIVTNSSAFRASRTALRPISNTVGLSHYALGANPNAFLANQYTFGA
IPNALRTSQYTLGTYPNALGVSQYALAAYPNAFGINQCTLGANPNVFWTNQYPLGTYPDAFGIGQYAWNMSPNVFGANQYTLGTNSDAFRPNCYSFVANPYDIRTNHYVL
ATNPNVSRTSQYILGANPNAFGSSHYSVGASQNVFGPNQHSFGVNGNFCGAAGSSGGTGGFNFSQVYGNFLNVCNTLPAFHGSNGDYFFLYSYGAYDVGSAPNYNVQINQ
STLLGNGYQGIYSAF*
47 >lcl|XP_234442.3|Plus1complement(7058570..7060702) NW_047762 SKI interacting protein Skiip __SEG__ Chr6 {Rattus norvegicus} MKRGFKIAFVPRSRPSGGRCWKTLRALRDSSRVSLHLEAEGLRSSLEGGSSLAKLSSDLAWVVDDIPPDSSGHSADEAPPSDNSPSSGSASGLQGPSLLESPRTSTPQSP
SPSRPSGTQSTRESPFTDPIALQCSPAIGVEACLRMYQLASRRRAAEGLRRRQEEQERKVRAFSEMACQQLERFDKLREQKLQKDFRDFRDMMEKGRREALGRQRKLRAE
HGLRAKLLALKLGEAEQQQRQKQAEQERLPVEEGQVSVRSLYTVQEEVLRLNRQLEASVQQHRDLLNVDLSAFQSRGTQLCGFISGLLPTTLDTGYPTAENQAGAEGALQ
EMRDLLFHLEQEISRATEVKEEEEAHIKGQESQGPQGPRAPAWTSAPSPSPEGTQEKEDPQLRVQDGTMHWYQRLQDASAKCELAFEDLSSSKDSQDRRIKMDLQKAATI
PVSQISSSAGSKLKEVFDKLHSLLSGQPVQSGGRPVSVSLHPQGLDFVQYKVAEKLVKQGESEVASHPEAAFPIAAVASGIWMLHPRVGDLILAQLHRQCPYSVPFHPAF
KEGMALEDYGRMLGYRVTDSKVEEQDHFLKRMSGMIRFYAAIIQLQWPYGDRQEAHPHGLQHGWRWLAQVLNLEPLPHVTATLLFDFLEVCGNALVKQYQVQFWKLVLVI
REDYLPRIEAITSSGQMGSVVRLQQFLDKCLQRREIPVPRGFLTPSFWNS*
48 >lcl|XP_234443.4|Plus1complement(7119753..7121618) NW_047762 DEAD-box protein abstrakt-like RGD1559513 __SEG__ Chr6 {Rattus norvegicus} MEEWEPERKRARRNQATAGASHSEDEDEDYVPYVPLRQRRQLLLQKLLQQRRKGAAEEEQQDSGSGSEPRGDEDNITLGPQSNVSLLDQHQRLKEKAEARKESAKEKQLK
EEEKILESVAEGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKLPAAILRGLKKKGILHPTPIQIQGIPTILSGRDM
IGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLHCALCIGGVSLKEQMETMRHGVHIMVATPGRLMDLLQKK
MVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKTPPPVLIFAKK
KADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLKAL
LLEAKQKVPPVLQVLHCGDESMLDIGGEQGCAFCGGLGHRITDCPKLEAMQTKQVSNIGHKDYLAHSSMDF*
49 >lcl|XP_577651.1|Plus112848260..12848688 NW_047531 small nuclear ribonucleoprotein D3 RGD1560685 __SEG__ Chr19 {Rattus norvegicus} MSIGRPIEVLQEAQGYMVTRETITGEVYPGKLIEAEDNMNCQMSNITVTYRDGPVAQPEQVYICDTKIRFPILPNMLKNAPVLENLKNKNQGSRAGQGKAAILKAQVAAR
GRGHEMGPWKLPEAKTVFSIKENFPSCLLLGF*