SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro A    

ID / Description / Sequence
1 >lcl|NP_001065269.1|Plus1955762..956910 NW_003459077 polyadenylate-binding protein 5 PABPC5 __SEG__ ChrX {Pan troglodytes} MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFI
KNLDKSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFC
EYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPPGVPIYIKNLDETINDEKLKEEFSSFGSISR
AKVMMEVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQARRRC*
2 >lcl|NP_001091892.1|Plus118040483..18041445 NT_106996 heterogeneous nuclear ribonucleoprotein A1-like 1 HNRNPA1L2 __SEG__ Chr21 {Pan troglodytes} MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGG
NFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
3 >lcl|XP_001139222.2|Plus14975092..4975931 NW_003457704 hypothetical protein LOC738374 LOC738374 __SEG__ Chr11 {Pan troglodytes} MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPLEPHTKAPRGFAFVRFHDRSDAQDAEAAMDGAVLDERELRVRMARYGRRDLPRSSQEEPRGRSW
GGRYGRRSRSPRGRHRSQSRGPSYSRSRSRSHYGGSRYSLSTYRRSRYRRSRYGRSPYSRSYSRHHYSRSPYRESRYRRSPYIRSSRSRSPYRRSHLKSGSHSASPSTSK
SSSPRRSKSSSISRSCSRSRSRSTSGSPPPPPSKRESKSRSRSKSPPKSPEGEKGQVPS*
4 >lcl|XP_001139465.2|Plus15004666..5005514 NW_003457704 serine/arginine-rich splicing factor 8 SRSF8 __SEG__ Chr11 {Pan troglodytes} MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSR
GGRYGRRSRSYGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRS
ASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS*
5 >lcl|XP_001139949.2|Plus117060..18409 NW_003459091 heterogeneous nuclear ribonucleoprotein H2 isoform 4 HNRNPH2 __SEG__ ChrX {Pan troglodytes} MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTAND
GFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYN
SIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGE
ADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQEN
SSDYQSNLA*
6 >lcl|XP_001141536.1|Plus1complement(4402074..4403207) NW_003457733 RNA-binding motif, single-stranded-interacting protein 2 isoform 2 RBMS2 __SEG__ Chr12 {Pan troglodytes} MAPPSPSNSTPNSSSGSNGNDQLSKTNLYIQGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMVKQQEQDPTNLYIS
NLPLSMDEQELEGMLKPFGQVISTRILRDTSGTSRGVGFARMESTEKCEAIITHFNGKYIKTPPGVPAPSDPLLCKFADGGPKKRQNQGKFVQNGRAWPRNGDMGVMALT
YDPTTALQNGFYPAPCNSTPSRMLARSALSPYLSSPVSSYRRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLCLSSTGTYMPTAA
AMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDTPSEHGVYSFQFNK*
7 >lcl|XP_001142796.2|Plus1complement(6202303..6203283) NW_003457706 putative heterogeneous nuclear ribonucleoprotein A1-like 3-like isoform 4 LOC737627 __SEG__ Chr11 {Pan troglodytes} MSKSESPKEPKQLRKLFIGGLRFETSDESLRSHSEQWGTLTECVVMRDPNTNRSRGFGFVPYATVEEVDAAMNARPHKMGGRVVEPKTAVSREDSQRPGAYLTVKKIFVG
GIKEDTEEHPLRDYYEQYGNTEVIEIMTDQGSGKKRDFAFVTFDNHDSTDKIVIQKYHIVNGHNCEVRKALSKQKMASAPSSQRSRSGSGNFGGGRGGGFSGNDNFGHGG
NFSGCGGFGGSRGGGRYGGSADGYNGFGNDGKNFGGGSSYNDFGNYNNRSSNFGPMKGGNFGGKRSCLYGGGGQYFAKPQNQGGYRGSSSSSSYGSGRRFQLGNKT*
8 >lcl|XP_001144332.1|Plus12376048..2377010 NW_003456693 heterogeneous nuclear ribonucleoprotein A1-like isoform 1 LOC737462 __SEG__ Chr2A {Pan troglodytes} MSKSESPKEPEQLRKLFFGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGG
NFSGHGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
9 >lcl|XP_001145824.1|Plus14846875..4847336 NW_003457620 H/ACA ribonucleoprotein complex subunit 2-like isoform 1 LOC450606 __SEG__ Chr10 {Pan troglodytes} MTKIKVDPEGPEAQAEVCSGERTYQELLVNQNPIAQLLASHRPKRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPLRCEDRNLPYVYIPS
KTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL*
10 >lcl|XP_001146071.2|Plus1893765..894187 NW_003458542 NTF2-related export protein 1 isoform 1 NXT1 __SEG__ Chr20 {Pan troglodytes} MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFN
QNFILTAQASPSNTVWKIASDCFRFQDWAS*
11 >lcl|XP_001146413.2|Plus1complement(6519..7481) NW_003469455 heterogeneous nuclear ribonucleoprotein A1-like isoform 3 LOC743119 __SEG__ Chr9 {Pan troglodytes} MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVNFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGG
NFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
12 >lcl|XP_001146647.1|Plus1complement(155..1036) NW_003456477 heterogeneous nuclear ribonucleoprotein C-like 1-like isoform 4 LOC737686 __SEG__ Chr1 {Pan troglodytes} MASNITNKMDPHSMNSRVFIGNLNTLVVKKSDVEVIFSKYGKIAGCSVHKGFAFVQYDKEKNARAAVAGEDGRMIADQVVDINLAAEPKVNRGNAGVKRSAAEMYGSSFD
LDYGFQRHYYDGMYSFPARVPPPPPIALAVVPSKRQRVSGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDLQAIKQELTQIKQKVDSLLENLEKNEKEQSKQEVEVKNAKS
EEEQSSSSMKNDETHVKIESEGGAEDSAEEGDPLDDDDNEDQGDNQLHLIKNNVKEAEEGEDDRDSTNGQDDS*
13 >lcl|XP_001147066.2|Plus1complement(1472701..1473963) NW_003458381 mRNA-decapping enzyme 2 isoform 1 DCP2 __SEG__ Chr18 {Pan troglodytes} METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLE
NVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGL
APNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSP
NQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSNEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL*
14 >lcl|XP_001147262.1|Plus1complement(8868..9809) NW_003459615 heterogeneous nuclear ribonucleoprotein C-like 1-like isoform 3 LOC738007 __SEG__ Chr1 {Pan troglodytes} MSSPSLLLFLAFGETLSSNTMASNITNKMDPHSMNSRVFTGNLNTLVVKKSDVEVIFSKYGKIAGCSVHKGFAFVQYDKEKNAWAAVAGEDGRMIASQVVDINLAAEPKV
NRGNAGVKRSAAEMYGSSFDLDYGFQRHYYDGMYSFPARVPPPPPIALTVVPSKRQRVSGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDLQAIKQELTQIKQKVDSLLEN
LEKIEKEQSKQEVEVKNAKSEEEQSSSSMKNDETHVKMESERGAEDSAEEGDPLDDDDNEDQGDNQLELIKNNEKEAEEGEDDRDSTNGQDDS*
15 >lcl|XP_001148290.1|Plus1224209..225060 NW_003457525 ribonuclease P protein subunit p38 isoform 1 RPP38 __SEG__ Chr10 {Pan troglodytes} MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVR
KQLAIGVNEVTRALERSELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALGFKKNTTDFVDEVTAIIPRVPSLSVPWLQDRIEDSGENLE
TEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLVPNPNKIRKPPKSKKATPK*
16 >lcl|XP_001152593.1|Plus1complement(22391..23272) NW_003460429 heterogeneous nuclear ribonucleoprotein C-like 1-like isoform 2 LOC742000 __SEG__ Chr1 {Pan troglodytes} MASNVTNKMDPHSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIAGCSVHKGFAFVQYDKEKNARAAVAGEDGRMIADQVVDINLAAEPKANRGNAGVKRSAAEMYGSSFD
LDYGFQRHYYDGMYSFPARVPPPPPIALAVVPSKRQRVSGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDLQAIKQELTQIKQKVDSLLENLEKIEKEHCKQGVEVKNAKS
EEEQTSSSLKKDKTHVKMESEGGADDSVEEGDLLYDDDNEDQGDNQLELIKDDEKEAEEGEDNRDSTNGQDDS*
17 >lcl|XP_001154541.1|Plus16588171..6590072 NW_003457785 polyadenylate-binding protein 3 isoform 5 PABPC3 __SEG__ Chr13 {Pan troglodytes} MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDLITRGSSNYAYVNFQHPKDAEHALDTMNFDVIKGKPLRIMWSQRDPSLRKSGMGNIFVKNLDKSI
NNKALYDTVSAFGNILSCNVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLNGRKVFVGQFKSRKEREAELGARAKEFPNVYIKNFGEDMDDERLKDLFGKFGPALSV
KVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTFEQMKQDRITRYQVVNLYVKNLDDDIDDERLQKAFSPFGTITSAKVMMEGG
RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAYLTNEYMQRMASVRAVPNQRAPPSGYFMTAVPQTQNHAAYYPPSQITQLRPSPRWTAQGARPHP
FQNKPSAIRPGAPRVPFSTMRPASSQIPRVMSTQRVANTSTQTVGPRPAAAAAAAAAATPAVRTVARYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQETLTASRLASA
PPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV*
18 >lcl|XP_001156174.1|Plus1complement(1122206..1123453) NW_003457543 heterogeneous nuclear ribonucleoprotein F isoform 6 HNRNPF __SEG__ Chr10 {Pan troglodytes} MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSAND
GFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD*
19 >lcl|XP_001158875.2|Plus17181350..7181685 NW_003456532 prothymosin alpha-like isoform 2 PTMA __SEG__ Chr1 {Pan troglodytes} MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDED
D*
20 >lcl|XP_001160555.1|Plus1complement(1072044..1072811) NW_003457728 testis-specific H1 histone H1FNT __SEG__ Chr12 {Pan troglodytes} MEQALTGEAQSRWPSRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKSGSHEAPRGQAKATLLR
VSGSDAAGYFRVWKVPKPRRKPGRARQEEGTRAPWRTPAAPWSSRRRRQPLRKAARKAREVWRRNARAKAKANARARRTRRARPRAKEPPCARAKEEAGATAADEGRGQA
AKEDTTPRSGKDKRRSSKPREEKQQPKKPAQRTIQ*
21 >lcl|XP_001162119.1|Plus120094350..20094913 NW_003457184 heterogeneous nuclear ribonucleoprotein A1-like LOC748594 __SEG__ Chr7 {Pan troglodytes} MSICLKHVFFVAARPCHHCAWLSSQIYKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFSRGGNFSGRGGFGGSRGGGGYGGSGDG
YNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
22 >lcl|XP_001163035.1|Plus1complement(1601939..1603816) NW_003457573 cleavage stimulation factor subunit 2 tau variant isoform 4 CSTF2T __SEG__ Chr10 {Pan troglodytes} MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPI
IDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQSVSVSGPGPGPGPG
AGPGLCPGPNVLLNQQNPPAPQPQHLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGAGPGSLTPGGAMQPQLGMPGVGPVPLERGQVQMSDPRAPIPRGPMTPGGLPP
RGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGSRDSRAMETRAMETEVLETRVMERR
GMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGAGMQGAGIQGAGMQGAGIQGGGMQGAGIQGV
SIQGGGMQGASKQGGSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS*
23 >lcl|XP_001164866.1|Plus1complement(3705166..3706023) NW_003456960 CCR4-NOT transcription complex subunit 7-like isoform 1 LOC461297 __SEG__ Chr4 {Pan troglodytes} MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQ
DSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELER
IGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCAHLYGLCSGSSYVQNGTGNAYEEEANKQS*
24 >lcl|XP_001168539.1|Plus126846835..26847953 NW_003457847 heterogeneous nuclear ribonucleoprotein A1 isoform 3 HNRNPA1 __SEG__ Chr14 {Pan troglodytes} MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGQSGSGNFGGGRGGGFGGNDNFGRGG
NFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKG
GNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
25 >lcl|XP_001169959.1|Plus1complement(24130018..24130938) NW_003457058 heterogeneous nuclear ribonucleoprotein A0 HNRNPA0 __SEG__ Chr5 {Pan troglodytes} MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVA
EGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSY
GGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF*
26 >lcl|XP_001171339.2|Plus131930093..31931055 NW_003456849 putative heterogeneous nuclear ribonucleoprotein A1-like 3-like isoform 3 LOC746306 __SEG__ Chr2B {Pan troglodytes} MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQRGTLTDCVVMRDPNTKCSTGFGFVTYATVKEVEAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKTFVG
GIKEDTEEHHLRDYFEQYGKTEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKTVIQKYHTVNGHNCEVRKALSKQEMTSASSSQRGRSGSGNFGGGCGGGFSGNDNFGHGR
NFSGRGGFGGSRGGGGYDGSGDGYNGFGNDGSHFGGGGSYNDFGNYNNQSSNFGPVKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
27 >lcl|XP_003308094.1|Plus1complement(155032..155385) NW_003456526 small nuclear ribonucleoprotein Sm D1-like LOC100610617 __SEG__ Chr1 {Pan troglodytes} MKLVRFLMKLSHETVTIILKNRTQVHGTVTGVDVSMNTHLKAVKMTPKNREPVQLETLSIRGNNIRYFILLDSLPLDTLLVDVEPKVKSEKREAVAGRGRGRGRGRGHGR
GRGGPRR*
28 >lcl|XP_003308732.1|Plus1complement(3786418..3786849) NW_003456643 probable ATP-dependent RNA helicase DDX59-like LOC100612437 __SEG__ Chr1 {Pan troglodytes} MFVPRSLKIKRNANDDGRSCVAKIIKPDPEDLQLDKSRDVPVDAVATEAATTDRHISKSCPFPSPGGKLAEVHSVSPEQGAKDSHPSEEPVKSFSKTQRWAEPGEPVCVV
CGRYGEYICDKTEWNVCSLECKAKLFYKFRTKE*
29 >lcl|XP_003308982.1|Plus16751463..6757225 NW_003456689 uncharacterized protein C2orf16-like LOC100612115 __SEG__ Chr2A {Pan troglodytes} MELTPGAQQQGINYQELTSGWQDVKSMMLAPEPTRKFPSGPLLTSVRFSNLSPESQQQDVKSLEFTVEPKLQSVKHVKLSSVSLQQTIKSVELAPGSLLQRVKYGEQTPR
TNYQIMESSELIPRPGHQFAKYAEMIPQPKYQIPKSANLISIPIYHATESSEMAQGLAYKGIDTVEKSVGLTPKLTGRAKESLGMLLQPDLQVPKFVDLTPMVRDQGSKF
LGLTPEKSYQILETMELLSQPRPQVKDVGELYMKPLQQTVEYEGITPELKHYFTEAMGLTAEARIQANEFFGMTPKPTSQATGFAERSPRLCPQNLECVEVISEKRLQGE
ESVVLIPKSLHHIPDSASRMTPGLGHRVPESVELTSKSGVQVEKTLQLTPKPQHHVGSPGIISGLGHQVPESVNLTCKQWLQREESSEVPLKQTSQVIGHEESVELTSEA
RQHREVSMGLTKSKNQSMKSPGTTPGPLGRIVEFMRISPEPLDQVTESARTQLQVAQSEEVILVDVPKVVQSVKVTPGPPFQIVKSVTIPRPTPQMVEYIELTPKLQHVR
PSEHHAGPCLQDVKSTKLITKPKHQILETVELTGFQIVKTMLIPGPSLQIVKSEELAPGPIPQVVEPIGVALESGIEAINCVDLLPRPHLQELIVPAELTPRPCIQVKSE
ELTSPQTSPFEEHTILTHKQGLQAVKSTVIKTEPPKVMETEDLNLGHVCQNRDCQKLTSEELQVGTDFSRFLQSSSTTLISSSVRTASELGGLWDSGIQEVSRALDIKNP
GTDILQPEETYIDPTMIQSLTFPLALHNQSSDKTANIVENPCPEILGVDVISKETTKRKQMEELENSLQRHLPQSWRSRSRTFQAASGVQKGLIKSFSGKQHNVWESHAW
KQRLPRKYLSTMLMLGNILGTTMERKLCSQTSLAERATADTCQSIQNLFGIPAELMEPSQSLPEKGPVTISQPSVVKNYIQRHTFYHGRKKRMALRIWTRGSTSSIIQQY
SGTRVRIKKTNSRFSGISQDVIQHMPVSCAGGQLPVLVKSESSLSIFYDREDLVPMEESEDSQSDSQTRISESQHSLKPNYLSQAKTDFSEQFQLLQDLQLKIAAKLLRS
QIPPDVPPPLASGLVLKYPICLQCGRCSGLNCHHKLQTTSGPYLLIYPQLHLVRTPEGHGEIRLHLGFRLRIGKRPQVSKYRERDRTVIRRSPISPSQRKAKIYTQASKS
PTSTVDLQSGPSQSPAPVQVYIRRGQRSSPDLVEKTKTRAPGHYEFTQVHNLPESDSESTQNEKRAKVRTKKTSDSKYPMKRITKGLRKHRKFYTNSRTTIESPSRELAA
HLRRKRIGATQTSTASLKRQPKKPSQPKFMQLLFQSLKRAFQTAHRVIASVGRKPVDGTRPDNLWASKNYYPKQNARDYCLPSSIKREKRSADKLTPAGSTIKQEDILWG
GTVQCRSAQQPRRAYSFQPRPLRLPKPTDSQSGIAFQTASVGQPLRTVQKDSSSRSKKNFYRNETSSQESKNLSTPGTRVQARGRILPGSSVKRTWHRHLKDKLTHKEHN
HPSFYRERTRHNPSWRNHRSPSERSQRSSLERRHHSPSQRSHRGPSRKNHSSPSERSWHSPSQRNHCSPPERSCHSLSERGLHSPSQRSHRGPSQRRHHSPSERSHRSPS
ERSHRSPSQRSHRGPSEGSHRSPSKRSHRGPARRSHRSPSERSHQSPSERRHHSPSERSHHSPSERSHHSPSERSHHSPSERSHHSPSERRHHSSLERSRHSLLESSHRS
PSERRSHRSFERSHRRISERSHSPSEKSHLSPLERSRCSPSERRGHSSSGKTCHSPSERSHRSPSGMRQGRTSERSHRSSCERTRHSPSEMRPGRPSGRNHCSPSERSQR
SPLKEGLKYSFPGERPSHSLSRDFKNQTTLLGTTHKNPKAGQVWRPEATR*
30 >lcl|XP_003309230.1|Plus1119610..119837 NW_003456773 small nuclear ribonucleoprotein G-like LOC100610134 __SEG__ Chr2A {Pan troglodytes} MSKAHPPELKKFMDKKLSLKLNGGRHVQGMLWSFDPFMNLVIDECVEMATGGQQNNIGMVVIGNSIIMLEALERV*
31 >lcl|XP_003309950.1|Plus1complement(8097..9044) NW_003456885 WD repeat-containing protein 82-like LOC736903 __SEG__ Chr3 {Pan troglodytes} MKLTDSVLRSFRVARVFCENSDKINCFDFSPNGQTVISSSNDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHEANTAVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRV
VALSMSPVDDIFISGSLDKTIRLWDLRAPNCQGLVNLQGKPVCSFDPEGLILAAGVNSEMVKLYDLRYFHKGPFTTFRMQCNRTCEWTGLKFSNDGKVILISTNGSFISL
IDAFKGVVMHTFEGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNAESGIKVAMLDGKHTGPITCLQFNPKFMTFASACSSMVFWLPTIDDSP*
32 >lcl|XP_003310825.1|Plus1complement(7268502..7268789) NW_003457057 u6 snRNA-associated Sm-like protein LSm2-like LOC736583 __SEG__ Chr5 {Pan troglodytes} MLFYYFFKSLVGKHVVVELKNDLSICGTLHSVDRYLNIKLTNISVIDPEKYPHMLSVKNCFIQGSVVRYMQLPADEVHKQLLQGAARKEPLQQKQ*
33 >lcl|XP_003312508.1|Plus1complement(3613063..3613251) NW_003457524 small nuclear ribonucleoprotein G-like LOC100614844 __SEG__ Chr10 {Pan troglodytes} MDKKLSMKLNGGRHVQGILQGLDPFMNLVIDECVEMATSGQQNNTGMVVIRGNSITMLEALE*
34 >lcl|XP_003313310.1|Plus12893487..2893714 NW_003457704 small nuclear ribonucleoprotein G-like LOC100609511 __SEG__ Chr11 {Pan troglodytes} MNKAHSLKLKKRMDKLSLKLNGGRCVQGILWGFSHFMNLMIDECVKMAISGQQNNIRTVEIGGNSITTLKALEQV*
35 >lcl|XP_003314216.1|Plus112682492..12682824 NW_003457820 prothymosin alpha-like LOC738256 __SEG__ Chr13 {Pan troglodytes} MSDAAVDASSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADSEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESPTGKRAAEDDEDDDVDTKKQKTDEDD
*
36 >lcl|XP_003315041.1|Plus1complement(1493743..1494021) NW_003458065 putative small nuclear ribonucleoprotein polypeptide E-like protein 1-like LOC741571 __SEG__ Chr16 {Pan troglodytes} MAYHGQDQRVQRVTVLPINLIFRYLQNRSWIQVWLYEQVNMWIEGCIIGFDKYMNLVLDDAEEIHSKTKSRKQLGRIILKGDNIPLLQSVSN*
37 >lcl|XP_003316032.1|Plus1369262..370365 NW_003458411 tRNA-specific adenosine deaminase-like protein 3 ADAT3 __SEG__ Chr19 {Pan troglodytes} MILCSRLCLPQSASLRMEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLL
CLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQMTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPAS
DRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDLRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPD
GALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT*
38 >lcl|XP_003317435.1|Plus197641..99536 NW_003458803 probable ATP-dependent RNA helicase DDX53 DDX53 __SEG__ ChrX {Pan troglodytes} MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWRGPFGHQGPRAAGSREPPLCFKIKNNMVGAVIGYSGSKIKDLQHSTNTKIQIINGESEAKVRIFGNREMKAKAKAAIE
TLIRKQESYNSESSVDNAASQTPIGRNLGRNDIVGEAEPLSNWGRIRAAVVEREKRKWADLPPVKKNFYIESKATSWISEMQVINWRKENFNIMCDDLKSGEKRLIPNPT
CRLQDAFQQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIEVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRKLALHVEAECSKYSYKGLKSICVY
GGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIMKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMMVYVGNLNLVAVNT
LKQNIIVTTEKEKQALTQEFVENMSPNDKVIMFVSQKHIADDLSSDFNIQGISAESLHGNSEQSDRERAVEDFKSGNIKILITTDIVSQGLDLNDVTHVYNYDFPRNIDV
YVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVMAEQYKLNQQKRHRKTRSRKHGQRRKKFYFLS*
39 >lcl|XP_003317861.1|Plus1complement(8778..9677) NW_003460418 heterogeneous nuclear ribonucleoprotein C-like 1-like LOC465453 __SEG__ Chr1 {Pan troglodytes} TLSSNTMASNVTNKTDPHSMNSRVFIGNLNTLVVKKSDVEVIFSKYGKIAGCSAHKGFAFVQYDKEKNARAAVAGEDGRMIADQVVDINLAAEPKANRGNAGVKRSAAEM
YGSSFDLDYGFQRHYYDGMYSFPARVPPPPAMALAVVPSKRQRVSGNTSRKGKSGFNSKSGKRGSSKSGKLKGDDLQAIKQELTQIKQKVDSLLENLEKIEKEQSKQEVE
VKNAKSEEEQSSSSMKNDETHVKMESEGGADDSAEEGDPLDDDDNEDQGDNQLELIKNNEKEAEEGEDNRDSTNGQDDS*
40 >lcl|XP_003317863.1|Plus14029..4928 NW_003460444 heterogeneous nuclear ribonucleoprotein C-like 1-like LOC742672 __SEG__ Chr1 {Pan troglodytes} TLSSNTMASNVTNKMDPHSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIAGCSVHKGFAFVQYDKEKNARAAVAGEDGRMIADQVVDINLAAEPKVNRGNAGVKRSAAEM
YGSSFDLDYGFQRHYYDGMYSFPARVPPPPAMALAVVPSKRQRVSGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDLQAIKQELTQIKQKVDSLLENLEKIEKEQSKQEVE
VKNAKSEEEQSSSSMKNDETHVKMESEGGADDSVEEGDLLYDDDNEDQGDNQLELIKDDEKGAEEGEDNRDSTNGQDDS*
41 >lcl|XP_003318052.1|Plus1complement(<61..>612) NW_003472301 mRNA-decapping enzyme 1B-like LOC749507 __SEG__ Chr12 {Pan troglodytes} TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVRSGDLHPLSELPENRPCENGSTHSA
GEFFTGPVQPGSPHNIGTSHGVQNASRTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGK
42 >lcl|XP_003318331.1|Plus1complement(1701069..1702982) NW_003457175 poly(A) polymerase beta-like LOC100610673 __SEG__ Chr7 {Pan troglodytes} MMPFPVTTQGPPQPAPPPKRYGVFSPISLAVPKETDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESKSLPQSVIENVGGKIFTFGSYRLGVHT
KGADIDALCVAPSHVDRSDFFTSFYAKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDN
FRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
SISTRMVMIEEFKQGLAITHEILLSKAEWSKLFEAPSFFQKYKHYIVLLASASTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENPDMEEFCTMWVI
GLGLKKPENSEILSIDLTYDIQSFTDTVYRQAVNSKMFEMGMKITAMHLRRKELHQLLPHHVLQDKKAHSTEGRRLTDLNDSSFDLSAGCENSMSVPSSTSTMKTGPLIS
SSQGRNSPALAVVTASVANIQATEISLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVLSSTCLISHPDLQETQQQTYLIL*
43 >lcl|XP_003339040.1|Plus1complement(1363030..1364205) NW_003456546 heterogeneous nuclear ribonucleoprotein G CCBL2 __SEG__ Chr1 {Pan troglodytes} MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFG
AGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSY
SSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSS
RSDLYSSGCDRVGRQERGLPPSVERGYPSSRDSYSSSSRGAPRGAGPGGSRSDRGGGRSRY*
44 >lcl|XP_510683.2|Plus1complement(28867..29421) NW_003457954 u3 small nucleolar ribonucleoprotein protein IMP3 IMP3 __SEG__ Chr15 {Pan troglodytes} MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRR
LPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA*
45 >lcl|XP_511048.2|Plus1complement(1013632..1015254) NW_003458198 probable ATP-dependent RNA helicase DDX28 DDX28 __SEG__ Chr16 {Pan troglodytes} MALARPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPVLVRPGPLLVSARRPELNQPARLTLGHWERAPLASQGWKSRRARRDHFSIE
RAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPPLLRGRHVLCAAETGSGKTLSYLLPLLQRLVGQPSLDSLPIPAPRGLVLVPSRELAQQVR
AVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRRPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVG
ATFPEGVGQLLNKVASPDAVTTVTSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIF
QSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT*
46 >lcl|XP_513319.2|Plus1complement(3703469..3703840) NW_003456524 LSM10, U7 small nuclear RNA associated LSM10 __SEG__ Chr1 {Pan troglodytes} MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGK
GQGRWEFPPKNCK*
47 >lcl|XP_515530.2|Plus11599953..1601023 NW_003456693 poly(rC)-binding protein 1 isoform 3 PCBP1 __SEG__ Chr2A {Pan troglodytes} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
48 >lcl|XP_519086.2|Plus12737061..2737942 NW_003457177 hypothetical protein LOC463398 isoform 2 LOC463398 __SEG__ Chr7 {Pan troglodytes} MSCGRPHPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRSDAQDAEAAMDGAVLDGRELRVQMARYGRRDLPRSSQEEPSGRSW
GGRYGRRSRSPRGRHRSQSRGPSYSKSRSRSHYGGSGYSPSPYRRSRYSRSPYRRSHYRGSRYGRSPYSGSYSWHHYSRSPYRESHYRESRYRRSPYIRSSRNRSPYRRS
HSKSGSRSRSPSTSKSSSPRRSKSSSVSRSGSLSRSRSTSGSPPPTSKRESKSRSRSKSPPKSPEGEKGQVPS*
49 >lcl|XP_520443.1|Plus1complement(6038995..6039273) NW_003457279 putative small nuclear ribonucleoprotein polypeptide E-like protein 1-like SNRPEL1 __SEG__ Chr9 {Pan troglodytes} MAYSGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMQIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN*
50 >lcl|XP_526690.3|Plus1complement(2364202..2365488) NW_003456983 polyadenylate-binding protein 4-like PABPC4L __SEG__ Chr4 {Pan troglodytes} MRVLPELGETCLNSIAWPLCGDPEASTLEPGQSCDLVSPHRDCSKNSRGQTHSGKDKEMNVAAKYRMASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLG
YAYVNFLQLADAQKALDTMNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQGSKGYAFVHFQNQSAADRAIEEMNGKLL
KGCKVFVGRFKNRKDREAELRSKASEFTNIYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFVSFDSHEAAKKAVEEMNGRDINGQLIFVGRAQKKVERQ
AELKQMFEQLKRERIRGCQGVKLYIKNLDDTIDDEKLRNEFSSFGSISRVKVMQEEGQSKGFGLICFSSPEDATKAMTEMNGRILGSKPLSIALAQRH*