SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus A    

ID / Description / Sequence
1 >lcl|NP_001004147.1|Plus1complement(1115870..1116814) NT_096135 rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1 Fbll1 __SEG__ Chr11 {Mus musculus} MKPAGGRGGWGWGGGKGGSKGGDTGSGTKGGFGARTRGSSGGGRGRGRGGGGGGGGGGGDRQRRGGPGKNKNRRKKGITVSVEPHRHEGVFIYRGAEDALVTLNMVPGVS
VYGEKRVTVMENGEKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTNIIPVLEDARHPLKYRML
IGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRPPPKSK*
2 >lcl|NP_001013394.2|Plus1complement(246293..247135) NT_039202 ribonuclease P protein subunit p38 Rpp38 __SEG__ Chr2 {Mus musculus} MAAAPQAPKRGSIRKTRPLVVKTSLNNPYVISWSTLEREDIHFILQTLEAKFKLIGLQKIEDKKKRKKTALMKKQSCRPDIEISEDPKEPDGDVLVSGWTPVHVRKQLVI
GVNEVTRALERNELLLVLVCKSVKPAIITSHLIQLSLSRTVPACQVPQLSERIAPVIGLKCVLALGFRKNTRDFADEVEAIIPRVPSLNVPWLPDRTQGPTDSLETEPSE
SQDNEILDTSFDDLTKLSKRKLAEGGQASAATLQPLKIKKLIPNPSKIRKPPKSKKSISK*
3 >lcl|NP_001094076.1|Plus122400462..22401511 NT_039500 tRNA-specific adenosine deaminase-like protein 3 Adat3 __SEG__ Chr10 {Mus musculus} MEPTSGFAEQPGPVKAESEEQEPAQWQALPVLSEQQSGAVELILAYAAPVLDKRQTSRLLREVSAVYPLPAQPHLKRVRPSRSAGGAQSSDLLLCLAGPSAGPRSLAELL
PRPAVDPRGLGTPFLVPVPARPPLTRSQFEEARAHWPTSFHEDKQVTSALAGQLFSTQERAAMQTHMERAVCAAQRAAAQGLRAVGAVVVDPASDRVLATGHDCSSVASP
LLHAVMVCIDLVAQGQGRGSCDLRSHPACSFTQATATQGARAGSVRKLDEDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGALGTLFRVHARPDLNHR
FQVFRGILEDQCRQLDPDP*
4 >lcl|NP_001094949.1|Plus1complement(5795478..5796590) NT_039229 poly(A) binding protein, cytoplasmic 4-like Pabpc4l __SEG__ Chr3 {Mus musculus} MSLEAKYRAASLYVGDLHEDVTEDMLFRKFSTVGPVLSIRICRDLISQRSLGYAYVNFLQVNDAQKALVTMNFDVIKGKSIRLMWSQRDACLRRSGVGNVFIKNLDKSID
NKTLYEHFSPFGTIMSSKVMTDGEGSKGYGFVHYQDRRAADRAIEEMNGKLLRESTLFVARFKSRKDREAELRDKPTEFTNVYIKNFGDDVDDEKLREVFSKYGQTLSVK
VMKDATGKSKGFGFVSFDSHEAAKNAVEDMNGQDINGQTIFVGRAQKKVERQAELKEMFEQMKKERIRARQAAKLYIKNLDDTIDDETLRKEFSVFGSICRVKVMQEAGQ
SKGFGLICFFSPEAAAKAMAEMNGRILGSKPLNIALGQKH*
5 >lcl|NP_001157308.1|Plus1complement(2146614..2148545) NT_039638 poly(A) binding protein, cytoplasmic 3 Pabpc6 __SEG__ Chr17 {Mus musculus} MNPSDPSYSLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVYRDRITRRSLGYASVNFQQLEDAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDRSI
DSKTLYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEEAERAIEKMNGMFLNDHKVFVGRFKSRRDRQAELGARAKEFTNVYIKNLGEDMDDERLQDLFGRFGPALSV
KVMTDESGKSKGFGFVSFERHEDARKAVEEMNGKDLNGKQIYVGRAQKKVERQTELKHKFGQMKQDKHKIERVPQDRSVRCKGVNLYVKNLDDGIDDERLRKEFSPFGTI
TSAKVTMEGGRSKGFGFVCFSSPEEATKAVTEMNGKIVATKPLYVALAQRKEERQAHLSNQYMQRMASTSAGPNPVVSPFQPAQGPSGYCMTATPTQSRRAYCAPNQTTQ
QGPSARGSAHGTRAHPFQNMSSTIHPSHTMPSFSTSGPTTSQAIRHRTASTSTQMMGPHPAAAAAAAAAPATRTITQYKYTAGVRNPPQHPNTQPHVSTQRSAVPVQGKE
SLTASMLASAPPQAQKQMLGEWLFSLIQAMHPALAGKITGMLLEIDNIELRHMLESPECLHTKVDEAIAVLQAHQAKETSQKAVSSVAGVPNA*
6 >lcl|NP_001159443.1|Plus1complement(13659095..13660057) NT_039618 predicted gene 5803 Gm5803 __SEG__ Chr15 {Mus musculus} MSKSESPKEPEQLRKLFIGGLSFQTTDKSLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGKVVEPKRAISRQDSQRPGAHLIVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRDFAFVTFDDHDSVDTIVIQKYHNVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGG
NFSGRGGFGGRRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKRGNFGGRSSGSYGSGGQYFAKPQNQGGYGGSSSSSSYGSGRRF*
7 >lcl|NP_001159905.1|Plus1complement(2658671..2660440) NT_039699 hypothetical protein LOC102991 isoform 1 AU022751 __SEG__ ChrX {Mus musculus} MASSSSPERGLEALRDTDESEGEAPGPSGPRGRGGPSGAGSALRLRSLEAEMAAACVTSTAGEDLGTFSEPGSQHGDPEGGGGPDLELGHARPMMRSQRELGLTPKGGGK
ADQGGKGRKGGSGSPPHTKSSRKREQPNPNRSLMAQGAAGPPLPGARGSPAMPQPESSLSPRPDQSHHFDFPVGNLEAPGPTLRSSTSQGSGSTPVPEALRCAESSRAES
DQSSPAGRELRQQASPRAPDDDDDGDGGPDPRGSGTPEGWVLRSGVVPFGRRSSASEVSPEEVRPEAQCTGWNLRPRPRSSASAVSPEARPKAQSAGRNLRPRPRSSASV
VSPEARPKAQSAGRNLRPRPRSSASVVSPEARPEAQSAGRNLRPRATPRVPVAPSSTTRSSSDRGSSRAPRSRSRSRSCSTPRLGSDHQRSRKIKMRLDLQVDREPESEA
EQEEQELESEPGPSSRPQASRSSSRFAVPGRSSLAAEDSPPRRPVRMRASSPSPPGRLYPLPKHYFEGVHSPSSSSSESSSVSSSHSPLNKAPDPGSSPPLSSLSGPNPF
WLALIADLDNLDSSSPRVPGEEIEAAPHTREEEDKKCRG*
8 >lcl|NP_001160106.1|Plus142134877..42135761 NT_039500 hypothetical protein LOC100043227 Gm4302 __SEG__ Chr10 {Mus musculus} MTTMADKMDMSLEDIIKLNKMQQGRRDRPDSRVKRGTGPKRYRPAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFG
TLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGMTRNPGSGVLSGGGTKRWTLGGSQGSGRGTSRNSKLQQQQQ
QQQQQQQQQQEEQKHQKQQQQKQQQQQQKQGQNHQHQQQQKEQQQQQQQKELQQLSVEELDAQLDYYQDMMDTS*
9 >lcl|NP_001160108.1|Plus1complement(42175691..42176560) NT_039500 hypothetical protein LOC100043247 Gm4312 __SEG__ Chr10 {Mus musculus} MTTMADKMDMSLEDILKLNKMQQGRLDRPDSRVKRGTGPKRYRPAFTHDGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFG
TLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGMTRNPGSGVLSGGGNKRWTLGGSQGRGRGTSRNSKLQQQQQ
QQQQQQQQQQQQEEQKHQKQQQQKQQQQQQKQGQNHQHQQQQKEKELQQLSVEELDAQLDAYQEMMDTS*
10 >lcl|NP_001160109.1|Plus142129718..42130587 NT_039500 hypothetical protein LOC100043224 Gm4301 __SEG__ Chr10 {Mus musculus} MTTMADKMDMSLEDILKLNKMQQGRLDRPDSRVKRGTGPKRYRPAFTHDGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFG
TLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGMTRNPGSGVLSGGGNKRWTLGGSQGRGRGTSRNSKLQQQQQ
QQQQQQQQQQQQEEQKHQKQQQQKQQQQQQKQGQNHQHQQQQKEKELQQLSVEELDAQLDAYQEMMDTS*
11 >lcl|NP_001160110.1|Plus142140011..42140880 NT_039500 hypothetical protein LOC100043231 Gm4303 __SEG__ Chr10 {Mus musculus} MTTMADKMDMSLEDIIKLNKMQQGRRDRPDSRVKRGTGPKRYRPAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFG
TLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGMTRNPGSGVLSGGGTKRWTLGGSQGSGRGTSRNSKLQQQQQ
QQQQQEEQKHQKQQQQKQQQQQQKQGQNHQHQQQQKEQQQQQQQKELQQLSVEELDAQLDYYQDMMDTS*
12 >lcl|NP_001160111.1|Plus142145132..42146001 NT_039500 hypothetical protein LOC100043235 Gm4305 __SEG__ Chr10 {Mus musculus} MTTMADKMDMSLEDIIKLNKMQQGRRDRPDSRVKRGTGPKRYRPAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFG
TLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGMTRNPGSGVLSGGGTKRWTLGGSQGSGRGTSRNSKLQQQQQ
QQQQQEEQKHQKQQQQKQQQQQQKQGQNHQHQQQQKEQQQQQQQKELQQLSVEELDAQLDYYQDMMDTS*
13 >lcl|NP_001160113.1|Plus142155377..42156246 NT_039500 hypothetical protein LOC100043239 Gm4307 __SEG__ Chr10 {Mus musculus} MTTMADKMDMSLEDIIKLNKMQQGRRDRPDSRVKRGTGPKRYRPAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFG
TLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGMTRNPGSGVLSGGGTKRWTLGGSQGSGRGTSRNSKLQQQQQ
QQQQQEEQKHQKQQQQKQQQQQQKQGQNHQHQQQQKEQQQQQQQKELQQLSVEELDAQLDYYQDMMDTS*
14 >lcl|NP_001171006.1|Plus145963838..45964644 NT_039500 THO complex 4-like Gm4340 __SEG__ Chr10 {Mus musculus} MTTMADKMDMSLEDIIKLTKIQQRRHDRPDSRVNRGTGSKRYRPAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFG
TLKKSAVHYDRCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDRQGRPAQSKNRGGMTRNPGSGVLSGGGTKKWTLGGSQGRGRGTIRNSKLQQQQQ
QQKQKQQQQQQKQQQKQQQKQQQKQQQQLSAEELDAQLDAYQEMMDTS*
15 >lcl|NP_035163.1|Plus136933338..36935224 NT_039674 poly A binding protein, cytoplasmic 2 Pabpc2 __SEG__ Chr18 {Mus musculus} MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRDVITRRSLGYASVNFEQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIKNLNKTI
DNKALYDTFSAFGNILSCKVVSDENGSKGHGFVHFETEEAAERAIEKMNGMLLNDRKVFVGRFKSQKEREAELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSV
KVMTDEGGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGRAQKKDDRHTELKHKFEQVTQDKSIRYQGINLYVKNLDDGIDDERLQKEFSPFGTITSTKVMTEGG
RSKGFGFVCFSSPEEATKAVSEMNGRIVATKPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNPVNPYQPASSSYSVAAVPQTQNCVPCCPSQIAQPRPSARWIAQGSR
PHPFPNVPGAIHPAAPRSSLTTVRPSSSHVQVTTAHRITNTSAQITGQRPAPASSATATPVHSIPQYKYAAGVQNSQQHLNAQLAQQPAVCIQGQEPWTASMLVTAPQEP
KQMLGERLFPLIQAMHPTLAGKITGMLLDIDNSEPLRMLESPVSRCSRAEEAVATLQAHQVKEAAQKAVGSTSGVPTV*
16 >lcl|NP_035793.1|Plus119873228..19874514 NT_039515 U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 Zrsr1 __SEG__ Chr11 {Mus musculus} MASRQTAIPEKLSRKQYKAAMKKEKRKKRRQKMARLRALEAPPEEDDDVSANEELAERLLEIERQRLHEEWLLREEKAQEEFRIKKKKEEAARKQKEEQERQIKAEWEEQ
QKKQREEEEQKLQEKREREEAVQKMLDQAENERIWQNPEPPKDLRLEKYRPSCPFYNKTGACRFGNRCSRKHDFPTSSPTLLVKSMFTTFGMEQCRRDDYDSDANLEYSE
EETYQQFLDFYHDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKVAICGLFEMQKCPKGKHCNFLHVFRNPNNEF
REANRDIYMSPPAWTGSSGKNSDRRERKDHHEEYYSKSRSYHSGSYHSSKRNRESERKSPHRWKKSHKQTTKSHERHSSRRGREEDSSPGPQSQSHRT*
17 >lcl|NP_035995.1|Plus1complement(38787801..38788871) NT_039353 poly(rC)-binding protein 1 Pcbp1 __SEG__ Chr6 {Mus musculus} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
18 >lcl|NP_062357.3|Plus115334915..15335571 NT_039185 RNA and export factor-binding protein 2 Refbp2 __SEG__ Chr1 {Mus musculus} MADKMDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARGGRNRPAPYSRPKPLPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDR
SGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVTSQIDPQRRPAQSGNRGGMTRSRGSGGFGGRGSQGRGRGTGRNSKQQQLSAEELDAQLDAYNARRDTS*
19 >lcl|NP_062735.4|Plus189542379..89542801 NT_039207 NTF2-related export protein 1 Nxt1 __SEG__ Chr2 {Mus musculus} MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDDATPSQTTVLVVICGTVKFEGNKQRDFN
QNFILTAQASPSNTVWKIASDCFRFQDWAS*
20 >lcl|NP_063921.1|Plus18703005..8704354 NT_039716 heterogeneous nuclear ribonucleoprotein H2 Hnrnph2 __SEG__ ChrX {Mus musculus} MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTAND
GFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYN
SIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGE
ADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQEN
SSDYQSNLA*
21 >lcl|NP_064327.1|Plus1complement(3845032..3846960) NT_039316 poly(A) polymerase beta Papolb __SEG__ Chr5 {Mus musculus} MMPFAVTTQGAQQPAPAPKQFGISSPISLAAPKDTDRELTQKLIETLQPFGVFEEEEELQRRILILQKLNNLVKEWIREISESRNLPQAVIENVGGKIFTFGSYRLGVHT
KGADIDALCVAPRHVDRNDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDS
FRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
SVSTRMVMIEEFKQGLAITHEILLNKAEWSKLFEAPSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKETADKEEFRTMWVI
GLVLKKPENSEILSIDLTYDIQSFTDTVYRQAINSKMFEMDMKIAAMHLRRKELHQLLPNHVLQKKETHLTESVRLTAVTDSSLLLSIDSENSMTAPSPTGTMKTGPLTG
NPQGRNSPALAVMAASVTNIQFPDVSLQHVNPIESSGIALSESIPQIPSQPTISPPPKPTMTRVVSSTHLVNHPSRPSGNTATNIPNPILGV*
22 >lcl|NP_082314.2|Plus1complement(33367056..33368678) NT_078575 probable ATP-dependent RNA helicase DDX28 Ddx28 __SEG__ Chr8 {Mus musculus} MALAGPSRLLALAVRLLLEPRRNLVVRGSDQSLPVVRVPRALQRRQEQRQSGRGSLQRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASRGWKHRRSRQDHFSIE
RVQQEAPALRNLSSRGSFVDLGLEPRVLLALQEAVPEVVQPTSVQSKTIPPLLRGRHLLCAAETGSGKTLSYLLPLFQRLLRGSDLDSRSFTAPRGLVLVPSRELAEQVQ
AVAQSLGGYLGLQVIELGGGLGMSRLKLQLYRRPAADVLVATPGALWKALKSQLISLQHLNFIVLDEVDTLLDESFLELVDYILEKSPIAESPAELEDPFNPKAQLVLVG
ATFPEGLNQLLSKVTSPDSLTTITSSKLHCLMPHVRQTFMRLKGADKVTELVQILKQQDKASKTEPSGTVLVFCNSASTVNWLGYILDDHKIQHLRLQGQMPASMRAGIF
QSFQKGSQNILVCTDIASRGLDSVHVEVVINYDFPPTLQDYIHRAGRVGRVGSEVPGSVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVGDPLPQKA*
23 >lcl|NP_083246.1|Plus1complement(397811..399508) NT_161902 RNA binding motif 31, Y-linked Rbm31y __SEG__ ChrY {Mus musculus} MNTASLAVEKDNETEQFREGFKIDATKNQQDASKMFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKDHKVDGKKIEFKRAKA
LESQFPNKKIFVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLENRYHFIGSSRCEVKMAYPKENPARQLSKRKAIAKDRTRKSVPA
VELENNWRGGGSPSFHIMANSEAQEANQDAHRAGSYTSRANSDVTLTNACGFRDSPNAFHVNSNVFVTNSTTFIASSNALRSSTNTVGVSHYTLDANPNTFLASQYTLGT
ISNTLRTSQYTLGTYPNALGVSQYALAAYPNTFGINQYPLEADQNAFWTNQYPLGTYSDAFGIGQYASGTSPNGFGVSQYSLGTNADTFRTNCFALVANPYNIWTNHYVL
ATNPNVFRTSQYVLGENPNAFESSQYSVGATQNNFGPNQHNFGANGNFCGTVGRGGSTGGLNFSQVYGNFLNVCNTLPGFQDSNGDYFVLYSYGAYDVRYAPNYNVQISQ
STLLGNDYQRIYSAF*
24 >lcl|NP_083808.1|Plus110954141..10954875 NT_078458 U11/U12 small nuclear ribonucleoprotein 35 kDa protein Snrnp35 __SEG__ Chr5 {Mus musculus} MSDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERALMKAYR
DADGLVIDQHEIFVDYELERTLRGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNEPHREGKRERRERSRSRDRHWDPRPRERDHDRGREKHWQERARVWPE
NDWEREREFREERVKSRDKRDRSK*
25 >lcl|NP_084148.1|Plus1complement(3769876..3770793) NT_039589 heterogeneous nuclear ribonucleoprotein A0 Hnrnpa0 __SEG__ Chr13 {Mus musculus} MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVA
EGDLIEHFSQFGAVEKAEIIADKQSGKKRGFGFVYFQSHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIHAGGGGARAARGGRGGGRGRGGGGGGGGRDQNGLAKGGGGG
GGGYNSYGGYGGYGAYGGGGGGGGSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSWGGRSNSGPYRGGYGGGYGGGSF*
26 >lcl|NP_112539.2|Plus124269451..24271349 NT_039687 cleavage stimulation factor subunit 2 tau variant Cstf2t __SEG__ Chr19 {Mus musculus} MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPI
IDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQPVSGPGPGGPGPSG
PGGPGPGPAPGLCPGPNVMLNQQNPPAPQPQHLPRRPVKDIPPLMQTSIQGGIPAPGPIPAAVPGPGPGSLTPGGAMQPQVGMPVVGPVPLERGQMQISDPRPPMPRGPM
PSGGIPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYMGPPHQGPPMHHGHDNRGPASHDMRGGPLAADPRMLIGEPRGPMIDQRGLPMDGRGGRESRGMETRPMETEVLEP
RGMERRMETCAMETRGMDARGLEMRGPGPSSRGPMTGGIQGPGPINMGAGGPQGPRQVPNIAGVGNPGGTMQGAGIQGGGMQGAGMQGGGMQGAGMQGGGMQGAGMQAGM
QGASMQGGMQGAGMQGASKQGGGQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS*
27 >lcl|NP_149068.1|Plus13463945..3465927 NT_039189 putative ATP-dependent RNA helicase Pl10 D1Pas1 __SEG__ Chr1 {Mus musculus} MSHVAEEDELGLDQQLAGLDLTSRDSQSGGSTASKGRYIPPHLRNREAAKAFYDKDGSRWSKDKDAYSSFGSRSDTRAKSSFFSDRGGSGSRGRFDERGRSDYESVGSRG
GRSGFGKFERGGNSRWCDKADEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLM
ACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMM
ERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEADKRSFLLDLLNATGKD
SLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNIN
ITKDLLDLLVEAKQEVPSWLENMAFEHHYKGGSRGRSKSRFSGGFGARDYRQSSGASSSSFSSGRASNSRSGGGSHGSSRGFGGGSYGGFYNSDGYGGNYSSQGVDWWGN
*
28 >lcl|NP_444344.1|Plus18571692..8572837 NT_039713 polyadenylate-binding protein 5 Pabpc5 __SEG__ ChrX {Mus musculus} MSGEPNTAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIK
NLDKTIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRERATFTNVFVKNFGDDIDDEKLNKLFSE
YGPTESVKVIRDATGKSKGFGFVRYETHEAAQKAVLELHGKSIDGKVLCVGRAQKKIERLAELRRRFERLKLKEKNRPSGVPIYIKNLDETINDEKLKEEFSSFGSISRA
KVMMEVGQGKGFGVVCFSSFEEACKAVDEMNGRIIGSKTLHVTLGQARHRW*
29 >lcl|NP_598595.1|Plus170186737..70187984 NT_039353 heterogeneous nuclear ribonucleoprotein F Hnrnpf __SEG__ Chr6 {Mus musculus} MMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSAND
GFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLDRMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD*
30 >lcl|NP_598737.1|Plus13205898..3206452 NT_039474 U3 small nucleolar ribonucleoprotein protein IMP3 Imp3 __SEG__ Chr9 {Mus musculus} MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREEYTRYNQLSRAVRELARRLRDLPERDPFRVRASAALLDKLYAMGLVPTRGSLELCDSVSASSFCRRR
LPTLLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLDA*
31 >lcl|NP_620046.1|Plus13690192..3690560 NT_109317 U7 snRNA-associated Sm-like protein LSm10 Lsm10 __SEG__ Chr4 {Mus musculus} MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFMNIRLANVTYTDRWGHQVELDDLFVTGRNVRYVHIPDGVDITATIEQQLQIIHRVRNFGGK
GQGRREFPSKRP*
32 >lcl|NP_666327.2|Plus137578314..37580617 NT_078575 ftsJ methyltransferase domain-containing protein 1 Ftsjd1 __SEG__ Chr8 {Mus musculus} MSKRRKLPARQPACLETFSPDVLNDVSELFAKSFSYRKPLDNEWQLPAPTESFSCGHLEFRALLDLKNSLNEVKNLLSDKKLDEWHRHTAFTNKAGKIISHVKKAVNAEL
CTQAWCKFQEILCSFPLIPQEAFQSGRLNSLHLCEAPGAFIASLNHYLKSHRFPCEWSWVANSLNPYHEANDNLRMITDDRLMANTLHCWYFGPDNTGDIMTLKYLTGLQ
DFLSGMSPIHLVTADGSFDCQGNPGEQEALVSSLHYCEAVTALITLGDGGSFVLKMFTLFEHCSVNLMYLLNCSFDQVHVFKPATSKAGNSEVYVVCLRYKGREAVQPLL
SRMVLNFGTEMTRKALFPHHVIPKSFLERHEECCTFFHRYQLETISENIRLFESMGTGEQERLNNLRDCAVQYFMQKFQLKPLSRNHWLVKKSNIGCSMNTKWFGQRNKY
FKTYNERKMMETLSWKDKVAKGYFNSWAEEHTVYHPGQNSLLEGTASSLEYQSWQVLEGKKLPKVKCSPFCDGEILKTLNEAIEKSLGEALSVDAKVSSKQQYRCCPVFS
EESVLSELLRLTKCLPDEQGAEPSGPVKCLLVGSPAVCDLQMPAPLEIQLVESVELTAFSCSLLHDGDPAYQHLFLDCLLHSLRRLHRGDVMVLPILSCFTRFMAGLTFV
LHGCFRFITFSCPTSLEPLRTCAVLLCIGYQNLPDAVFQFLQNVHDLLSKLLHPSAPRQILQFLPMEALLQGTLLDFLWDLNAAIAKRHLHLIIQGERDQAIGSLEL*
33 >lcl|NP_932758.1|Plus1177229..178302 NT_039614 heterogeneous nuclear ribonucleoprotein A3 isoform a Hnrnpa3 __SEG__ Chr14 {Mus musculus} MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGG
IKEDMEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGCGGN
FGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSF
GGRSSGSPYGGGYGSGGGSGGYGSRRF*
34 >lcl|XP_001004798.1|Plus117423583..17424302 NT_039548 mRNA turnover protein 4 homolog Gm9178 __SEG__ Chr12 {Mus musculus} MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDDLHQVSKKLRGEVGLLFTNRTKE
EVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMELQLRQLGLPTALEKGVVTLLSDYEVCKEGDVLTPEQARILKLFGDEMAEFKVTIKYMWDAQSGRFQQMDD
DLPESAPESEGESEEEDDS*
35 >lcl|XP_001475281.1|Plus121095281..21095754 NT_039621 serine/arginine-rich splicing factor 3-like Gm7083 __SEG__ Chr15 {Mus musculus} MHRDSCPLDCKVYVGNRGNNGNKTELERAFGYYGPLRNVWVARNPPGFAFVEFEDPRDDADAVRELDGRALCGCCVRVELSNDEKRSRNRGPPPPWGRSLRDDDRRRSPP
PRRRSPRRKSFSRSRSRSLSRDRRRERSLPRERNHKPSRSSLGLVAI*
36 >lcl|XP_001478216.1|Plus120187452..20187763 NT_039500 u6 snRNA-associated Sm-like protein LSm7-like Gm10146 __SEG__ Chr10 {Mus musculus} MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTMEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFVQQQDT*
37 >lcl|XP_001480247.1|Plus1complement(64768987..64769451) NT_078297 putative RNA-binding protein 3-like Gm15453 __SEG__ Chr1 {Mus musculus} MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGESLDGRQIRVDHAGKSARGSRGGAFGGRGRSYSRGGRDQGY
GSGRYDSRPGGYGYGYGRSRDYSGRSQGGYDRYSGGNYRDNYDN*
38 >lcl|XP_001480610.1|Plus1complement(18831966..18832685) NT_039548 mRNA turnover protein 4 homolog isoform 2 Gm5633 __SEG__ Chr12 {Mus musculus} MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDDLHQVSKKLRGEVGLLFTNRTKE
EVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMELQLRQLGLPTALEKGVVTLLSDYEVCKEGDVLTPEQARILKLFGYEMAEFKVTIKYMWDAQSGQFQQMDD
DLPESAPESEGESEEEDDS*
39 >lcl|XP_001480971.1|Plus169780219..69780575 NT_039500 small nuclear ribonucleoprotein Sm D2 isoform 2 Gm10120 __SEG__ Chr10 {Mus musculus} MSLLNKSKSEMTPEELQKRAEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDLVIVVL
RNPLIAGK*
40 >lcl|XP_001481216.1|Plus198035858..98036217 NT_039207 small nuclear ribonucleoprotein Sm D1-like isoform 2 Gm14277 __SEG__ Chr2 {Mus musculus} MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIQGTNIRYFILPDSLPLDTLLVDVEPKVKSRKREAVAGRGRGRGRGRGHGR
ARGRGGPRR*
41 >lcl|XP_003084482.1|Plus18870441..8871202 NT_039170 RNA and export factor-binding protein 2-like Gm6489 __SEG__ Chr1 {Mus musculus} MADKMGLSLEDIIKLNKIQQGRHNRPDSRVNRGTGPKRYKPAITHSGRNRLPPYRRPKQLPDKGQHDQFVGSFRAGNHMDTGGKLLLSNLHFGVSDADIQKLFAEFGTLR
KSAVHYDRSGQSLGTGHVHFERKADALKAMREYNGVPLDGRPMNIQLVTSKIDTQRRPAQSRNRGGMARNPGSGGYGGGGTRRETLGDSQGRGGTSRNSKKQQQQQQQQQ
KQQHHQQQQQQKQLSAEELDAQLDTYWEMMDTS*
42 >lcl|XP_003085163.1|Plus1complement(128415..129488) NT_039634 heterogeneous nuclear ribonucleoprotein A3-like LOC100505318 __SEG__ Chr16 {Mus musculus} MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHRVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGG
IKEDTEEYNLRDYFEKYGNIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGN
FGGRSGYGGGGGGSKGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSF
GGRSSGSPYGGGYGSGGGSGGYGSRRF*
43 >lcl|XP_003085225.1|Plus11585527..1585913 NT_039662 NHP2-like protein 1-like LOC100505330 __SEG__ Chr17 {Mus musculus} MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGVNEATKTPNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGS
QLKQQIQSIQQSIERLLV*
44 >lcl|XP_003085306.1|Plus147793144..47793833 NT_039706 polyadenylate-binding protein 1-like 2-like Pabpc1l2b-ps __SEG__ ChrX {Mus musculus} MDEELAAALAAEEEEAAAGGSDDGNPDFPTASLYVGDLHPEVTESMLYEKFSPAGPILSIRICRDKVTRRSLGYAYVNYQQPVDAKRALETMNFDVINGRPVRIMWSQRD
PSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDALNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADFKDFDD
DSDDEATFR*
45 >lcl|XP_003085337.1|Plus12473509..2475122 NT_039716 LOW QUALITY PROTEIN: hypothetical protein LOC237030 Gm4916 __SEG__ ChrX {Mus musculus} MNTVSLAVKKYNERNQFREGFKIDATKNQQDASKMFIGGLSQEVNKQVVLEYLSKFGEIIDFIIKIDPNTGLSRGFGFVLFKDSATVEKVLRVKEHKVDGKKIEVKRAKA
LESQFPIKKVFVGGLNPRMSEEKIRAYFGTFGQIEAIELPLCSDTQERRAFGFIKYKDENPVRKVLETRYHFIGSSRCEVKIAYPKENLARQLSKRKTIAKDRTRKSVPA
TELENNWRGGGSPSFHVMANPNAQEANQDADRAGSYTCRANSDVTSANAHSFRDTPNAFQVNSNDFVTNSTAFLASNNALNSSSNTVRVSHYDLEANPNTFLASQYTLGT
IPNTLRTSQYTLGTYPNALGVSHYALATYPDTFEINQYALGANQNAFGASRYSLGTNSDTFSTNRYALVANPYNIWTNHYVLATNPNVFRTSQYILGANPNAFGSSQYSV
GATQNNSGPNQHSFGANGNFGGAAGSGGSIGGLNFSQVYGNLLNDCNTLPAFHGSNGDYFVLYSYGAYDVRSAPNYNV*ISQSTLLGNGYQRIYSAF*
46 >lcl|XP_003085565.1|Plus1complement(10027443..10027934) NT_165773 serine/arginine-rich splicing factor 3-like LOC100502754 __SEG__ Chr11 {Mus musculus} MHRDSCLDCKVYVGNLGNNGNKTELEWAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGLPPSWGRRPRDDDRRRSPPP
RCRSPRRKSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSHSRSRSNERK*
47 >lcl|XP_139243.3|Plus185315633..85316112 NT_039606 hypothetical protein LOC223186 Gm4822 __SEG__ Chr14 {Mus musculus} MAKFNCYYCDMYLTHNSPSMRKTHCSGRKHKENVKDNCQKWMEEQAQSLIDKPTATFQQGKIPPVPFSGSLPAGAMIPQLPSLLDPPRSGRIPVSHMEGPPMMPMMSPPP
PGMMPMGPAPVMRPPIGGHMPMIPGPPMMRHGTLPMMVPTRPSMTWPDR*
48 >lcl|XP_356179.3|Plus1complement(356550..357395) NT_039477 u1 small nuclear ribonucleoprotein A-like isoform 1 Gm5161 __SEG__ Chr9 {Mus musculus} MAVPETRPNHTIYINSLNEKIKKDELKKSPYAIFSQFGQILDILVSQSLKMRGQSFVIFKEVSSTINALRSMQGFPFYGKPMHIQYAKTDSDIIAKMKGTFVERDRKREK
RKPKSQEKPAVKKGCSGWGSAPVVGAVQPVPGMPPMPQAPRVMHHMPGQPPYMRPPGMILPPGLPPGQIPSRAMPPQQLIPGQMPHAQPLSENPPNHILFLTNLPEETNE
LMLSMLFTQFPGFKEVRLVPGRHDIDFVEFDNEVQAGAARDVLQGFKITQNNAMKISFAKK*
49 >lcl|XP_486217.2|Plus135040978..35041364 NT_039472 NHP2-like protein 1-like Gm5616 __SEG__ Chr9 {Mus musculus} MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGS
QLKQQIQSIQQSIERLLV*
50 >lcl|XP_619909.1|Plus1complement(17495100..17495456) NT_039240 small nuclear ribonucleoprotein Sm D2-like Gm5848 __SEG__ Chr3 {Mus musculus} MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLSQSVKNNTQVLINCRNKKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSSKGKKKSKPVNKDCYISKIFLRGDSVIVVL
RNPLITGK*
51 >lcl|XP_891995.1|Plus17491432..7492241 NT_109317 serine/arginine-rich splicing factor 5-like Gm12966 __SEG__ Chr4 {Mus musculus} MSGCRVFIGRLNPAARVKDVERFFKGYGRIRDIDLKTGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRL
IVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIVGSKRHRSRSRSRSRTRSSSRSRSRSRSRRSKSYSRSRSRSRS
QSKSRSGSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN*
52 >lcl|XP_895391.1|Plus120624245..20624496 NT_039606 small nuclear ribonucleoprotein F Gm6616 __SEG__ Chr14 {Mus musculus} MSLPLNPKTSLNGLTGKPVMVKLKWGMEYLVSMDGYMNMQLANTEEYIDGELSEHLGEVLKRCNNVLYIRGIEEEEEDGEMRE*
53 >lcl|XP_986781.1|Plus1complement(35196668..35197945) NT_039621 splicing factor 3B subunit 4-like Gm7935 __SEG__ Chr15 {Mus musculus} MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPE
IDEKLLYDTFRAFGVILQTPKIMWDPDTGNSKGYSFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSA
PNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAGGHGPPAAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSG
GQPPPRPPPGMPHPGPPPMGMPPPRGPPFGSPMGHPDPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ*
54 >lcl|XP_990020.1|Plus1complement(12429722..12429952) NT_039649 small nuclear ribonucleoprotein G-like Gm8186 __SEG__ Chr17 {Mus musculus} MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
55 >lcl|XP_995150.2|Plus1280676..281605 NT_166318 u1 small nuclear ribonucleoprotein A-like Gm8587 __SEG__ Chr12 {Mus musculus} MATMPVLETRSNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSQSLKMRGQVFVIFKEVTIATNALWSMLGFPFYDKPMRIQYTKTESDNIAKMKGTFVERDHK
GEKRKPKSQETPAAKKAVQGGAAAPVVGAVQPVPGMPPMPQAPRIMHHVPGQPPYMPPAGMIPPTGLAPGQIPPGAMPPQQLMPGQMPPAPPLSENPPNHILFLTNLPEE
TNELMLSMLFTQFPGFKEAHLVPGCHDIAFVEFDNEVQAGAALDALQGFKITQNNAMKISFVKKERLSLWSTPVPSPRPLTQSLEVSPP*