SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul A    

ID / Description / Sequence
1 >lcl|NP_001038193.1|Plus1157026..158174 NW_001218163 polyadenylate-binding protein 5 PABPC5 __SEG__ ChrX {Macaca mulatta} MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFI
KNLDKSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFC
EYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPPGVPIYIKNLDETINDEKLKEEFSSFGSISR
AKVMMEVGQGKGFGVVCFSSFEEATKAVDEMNGRVVGSKPLHVTLGQARRRC*
2 >lcl|XP_001082690.2|Plus1complement(457846..458808) NW_001218155 heterogeneous nuclear ribonucleoprotein A1-like isoform 1 HNRPA1 __SEG__ ChrX {Macaca mulatta} MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHPVNGHNCEVRKALSKQEMASASSSQRSRSGSGNFGGGRGGGFGGNDNFGRGG
NFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
3 >lcl|XP_001082876.1|Plus1311596..311931 NW_001099014 hypothetical protein LOC693785 LOC693785 __SEG__ Chr13 {Macaca mulatta} MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEREADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESAAGKRAAEDDEDDDVDTKKQKTDED
D*
4 >lcl|XP_001083377.1|Plus1complement(1082730..1083086) NW_001105681 small nuclear ribonucleoprotein Sm D2-like LOC695079 __SEG__ Chr18 {Macaca mulatta} MSLLNKPKSEMTPEELQKREEEEFHTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRQDSVVLVL
RNSLIAGK*
5 >lcl|XP_001084279.1|Plus1complement(1526404..1527351) NW_001112539 WD repeat-containing protein 82-like LOC695534 __SEG__ Chr2 {Macaca mulatta} MKLTDSVLRSFRVARVFCENSDKINCFDFSPNGQTVISSSNDDSIVLYDCQEGKPKRTLYSKKYGVDLIRFTHEANTAVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRV
VALSMSPVDDIFISGSLDRTIRLWDLRAPNCQGLVHLQGKPVCSFDPEGLILAAGVNSEMVKLYDLRSFDKGPFTTFKMQCHRTCEWTGLKFSNDGKVILISTNGSFISL
IDAFKGVVMHTFEGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGETGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMVFWLPTIDDSP*
6 >lcl|XP_001086138.1|Plus11080..2042 NW_001101109 putative heterogeneous nuclear ribonucleoprotein A1-like 3-like isoform 2 HNRPA1 __SEG__ Chr14 {Macaca mulatta} MSKSESPKEPEQLRKLFIRGMSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYTTVEEVDAAINARPHKVDGRVVEPKRAVSREDSQRPGAHFTVKKTFVG
SIKEDTEEHHLRDYFDQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKTVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFSRGR
NFSGRGGFGGSHGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNCNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPQNQVGYGGSSSSSSYGSGRRF*
7 >lcl|XP_001086340.1|Plus1complement(2653178..2653699) NW_001124214 zinc finger protein 593-like LOC697802 __SEG__ Chr9 {Macaca mulatta} MKFKYEKIDIKKVRIGPEALTRVLTPLLLAPWPAGLFLAVGRSRRTGAHRAHSLARQMKVKRRRPDLDEIHRELRPLGPARPQPDPDAEPDLDLPGGGLHRCLACVRYFI
DSANLKTHFRSKDHKKRRKQLSVKPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST*
8 >lcl|XP_001087356.1|Plus11210745..1211035 NW_001120968 n-alpha-acetyltransferase 38, NatC auxiliary subunit NAA38 __SEG__ Chr6 {Macaca mulatta} MTSALENYVNRTVAVITSDGRMIVGTLKGFDQTINLILNESHERVFSSSQGVKQVVLGLYIVRGDNVAVIGEIDEETDSVLDLGNIRAEPLNSVAH*
9 >lcl|XP_001087489.1|Plus11436368..1436724 NW_001124216 small nuclear ribonucleoprotein Sm D2-like LOC696279 __SEG__ Chr9 {Macaca mulatta} MSLLNKPKSEMNPEELQKREEEEFNTGPLSVPTQSVKNNTQVLINCGNNKKLLGHVKAFDRHRNMVLENVKEMWTEVPKSGKGKKKSKPVNKDCYISKMFLHRDSVIVVL
RNLPIACE*
10 >lcl|XP_001087555.1|Plus1complement(142941..143171) NW_001101668 small nuclear ribonucleoprotein G-like LOC695633 __SEG__ Chr15 {Macaca mulatta} MSKAHPPELKKFMDKKLSSKLNGGRHVQGILWAFDPFMNLVIDEYVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
11 >lcl|XP_001087684.1|Plus14769070..4769300 NW_001105681 small nuclear ribonucleoprotein G-like LOC697334 __SEG__ Chr18 {Macaca mulatta} MSKAHPPELKKFMDKKLSLKLNGGRHVQGILWGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
12 >lcl|XP_001089715.1|Plus1complement(123..863) NW_001097974 u11/U12 small nuclear ribonucleoprotein 35 kDa protein-like LOC702933 __SEG__ Chr11 {Macaca mulatta} MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYR
DADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREAKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRLW
PDNDWERERDFRDDRVKGREKKERVK*
13 >lcl|XP_001089948.2|Plus1complement(2302354..2302758) NW_001096631 putative RNA-binding protein 3 RBM3 __SEG__ Chr11 {Macaca mulatta} MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGDSLDGRQIRVAHAGKSARETRGGGFGAHGRGRSYSRGGGDQ
GYGSGRYYDSRPGGYGYGYGRSRDY
14 >lcl|XP_001090488.2|Plus1196728..202754 NW_001098996 uncharacterized protein C2orf16-like LOC702215 __SEG__ Chr13 {Macaca mulatta} MELTPGAQQQGINYQELTSGWQDDESMMLAPESTRKFPSGPLLTSVRFSNLSPESQQQGVKSLEFTLEPKSQSIKHVKLSSVSLQEAIKSVELAPESLLQRVKYGEQTPK
TNYQIMESSEIIPRPGHQFTKYAEMIPQPMYQVPKSANLISIPIYHATESSEIVQGLAHKGIDTVEKSVGLTPKITGRAIESLGMLLQPDLQVPKFVDLTPMVRDQGSKF
LGLTPEKSYQILETMELLSRPRARVKDLGELYMKPLQQTVEYEGITPELKHYFTEAMRLTTEARIHANEFFGMTPKPTSQATGFAERSPRLCTQNLECVEAISEKRLQRE
ESVVLIPKSLHHVPDSALGMTPGLGHRVPESVELTSESGVQVEKTLQLTPKPQHHVVSPGIILGLGHQVPESVNLTCKQWLQREESLEVPLKQTSQVIGHEESVELTSEA
RQHREVSMGLTKSKNQSMKSPRTTPGPLGRIVEFMRISPEPLDQVTESARTQLHVAQSEEVILVDVPKVVQSVKVTPGPPFQIVKSVTIPRPTPQMVEYIELTPKLQHVR
PSEHHSGPCLQDVKSTKLIIKPKHQILETMELTGFQIVKTMLIPGPSLQIVKSEELAPGPIPQVVEPIGVALESGIEAINCVDLLPRPHLQELIVPAELTPRPRIQVKSE
ELTSPQTSPFEKHTILTHKQGLQAVKSTVIKTEPPKVMETKDLNLGQVCQNRDCEKLTSEELQAGTDFSRFLQSSSTTLISSSVRTASELGGLWDSGIQEVYRALDIKNP
GTDILQPEETYIDPTMIQSLILPLALHNQSSDKTANTVENPCPEIPGVDVISKETTKRKQMEELENSLQRHLLQSWRSLSRTFRAESGVQKGLIKSFLGRQHNVWESHAW
RQRLPRKYLSTMLMLGNILGTTMERKLCSQTSLAERATADTCQSIQNLFGIPAELMEASQSLPEKGPVTISQPSVVKNYIQRHTFYHGHKKRMALRIWTRGSTSSIIQQY
SGTRVGIKKTNLRFSGISQEVIQHMPVSCAGGQLPVLVKSESSLSIFYDREDLVPMEESEDSQSDSRTRISESQHSLKPNYLSQAKTDFSEQFQLLQDLQLKIAAKLLRS
QIPPDVPPPLASGLVLKYPICLQCGRCSGLNCHHKLQTTSGPYLLIYPQLHLVRTSEGHGEIRLHLGFRLRIEKRPQISKYRERDRPIIRRSPILPSRRKAKIYTQASKS
PASTIDLQSGPSQSPAPVQFYIRRGQRSSPDLVEKTKIRAPGHYEFTQVHNLPESDSESTQNEKRAKVRTKKTSDSKYPMKRITKGLRKHRKFYKNSRTTIESPSRELPA
YLRRKRIGATQTSTASLKRQPKKPSQPKFMQLLFQSLKRAFQTAHRVIAFVGRKPVDRTRPDNLWGSKNYYPKQNTRDYCLPSSIKRDKRSADKLTPAGSTIKQEDILWG
GTGQCRSAQQQRRAHSFQPRPLRLPKPTDSQSGIAFQTASVGQPLGSVQKDSSSRSKKNFYRNETSSQESKNLSTPGTRVQARGRILPGSPVKRTWHRHLKEKLTHKEHN
HPSFYKERTPRSPSERTRHNPSWRNHRSPSERSQRSPSERRHHSPSERRQHSPSQRSHRSPSRKNHSSPSERSRRSLSWRNHCSPSERSCHSLSERGPHSPSQRSHRSHS
QRRHHSPSERSHRSPSQRNHRGPSQRRYHSPSERSRSSPSERRHRSPSERRYRSPSQRSHSSPSERRQHSPSQRRHRSPSQRSHRSPSQRRYHSPSERSRSSPSERRHRS
PSERRHRSPSERRHRSPSQRSHRSPSQRRHRSPSERSHRSPSQRSHRSPYERRHHSPSERRHHSPLERSRHSLSERSHRSLSERSHRSPSERRSHRSFERSHRRISERSH
SPSEKSPLSPLERSRCSPSERRGHSSSGKACHSPSERSHHSPSGMRQGRPSERNHRRSCERTRHSPSEMRPGRPSGRNHRSPSERSRRSPLKEGLKYSSPGERPSHSLSR
DFKNQTSLLGTTHKNPKAGQVWRPEATR*
15 >lcl|XP_001090747.1|Plus1complement(3285287..3285640) NW_001218196 splicing factor 3A subunit 3-like LOC702443 __SEG__ ChrX {Macaca mulatta} MPSFGLKIDFFFYKLHGLNINYNCEICGNYSDRGPKAFQRHFAKWRHAHGMRCLGNPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYED
LKRQGLL*
16 >lcl|XP_001091129.1|Plus14542991..4544904 NW_001104429 polyadenylate-binding protein 1 isoform 2 PABPC1 __SEG__ Chr17 {Macaca mulatta} MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSRAGPILSIRVCRDVITRRSSSYAYVNFQHPKDAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNIFVKNLDKSI
NNKVLYDTVSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGTLLNDRKVFVGRFKSRKEREAELGAKAKEFPNVYIKNFGEDMDDERLKDLFGKFGPALSV
KVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGRAQKKVERQTELKRKFEQMKQDRITRYQVVNLYVKNLDDDIDDERLRKAFSPFGTITSAKVMMEGG
RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNEYMQRMASVRAVPNPVINPYQPAPPSGYFMAAVPQTQNRAAYYPPSQIAQLRPSPCWTAQ
GARPHPFQNKPGGIRPAAPRLPFSTMRPTSSQVPRVMSTQRVANTSTQTVGPRPAAAAAAAATPAVRTVPRYKYAAGVRNPQQHLNAQPQVTMQQSAVHVQGQETLTASM
LASAPPQEQKQMLGERLFPPIQAMHPTLAGKITGMLLEIDNSELLHMLESPQSLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV*
17 >lcl|XP_001091350.1|Plus13455489..3455950 NW_001218172 nuclear cap-binding protein subunit 2-like LOC703043 __SEG__ ChrX {Macaca mulatta} MSKGLKILCKDPVLELSCCRDHQFSGSKFQQEKLLKESSTMNMRNLSFYTTEEKIHELFSRSDIRNIFMGLDKIKKTACGFCFVECHNRADAENAMRFLNGTCLDEWIIC
TDWDIGFREGQQYGRGKSGGQVRDEFREDFHSGRGGFGRQSQI*
18 >lcl|XP_001091930.1|Plus15565889..5566896 NW_001120995 rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1-like LOC703625 __SEG__ Chr6 {Macaca mulatta} MKSAASSRGGGGGGRGGGGWGGWGGGRGGGGGAGKGGGGDGGGPGGKGGFGARARGFGGGGRGRGRGGGDDKDRGGGGGQRRGGVAKSKSRRRKGAMVVSVEPHRHEGVF
IYRGAEDALVTLNMVPGQSVYGERRVTVTEGGVKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKR
TNIIPVLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRPLP
KSSTK*
19 >lcl|XP_001093268.1|Plus1876386..876661 NW_001120965 u6 snRNA-associated Sm-like protein LSm5 LSM5 __SEG__ Chr6 {Macaca mulatta} MAADATTNPSQLLPLEFVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLQDVTEFEITPEGRRITKLDQILLNGNNTTMLVPGGEGPEV*
20 >lcl|XP_001093862.1|Plus11900553..1901902 NW_001218169 heterogeneous nuclear ribonucleoprotein H2 isoform 1 HNRPH2 __SEG__ ChrX {Macaca mulatta} MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTAND
GFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYN
SIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGE
ADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQEN
SSDYQSNLA*
21 >lcl|XP_001094190.2|Plus1complement(2954..3265) NW_001124405 hypothetical protein LOC705249 LOC705249 __SEG__ Chr9 {Macaca mulatta} MLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGRCRLGPRQGPAQLAALASRARLEGIKLNPCHNRKQLLYV*
22 >lcl|XP_001095702.2|Plus1272278..272880 NW_001218143 ATP-dependent RNA helicase DDX3Y DDX3X __SEG__ ChrX {Macaca mulatta} MSHMVIENALDLEEQFAHLDLNASDKQSGGGSTASQECYIPPHLRNKEASKGFYDKDSSGWSCSKDKDAYSSFGSPDSRGKPGYFSDYGSGSRGRFDDPGWSDYDGIGSH
GDRTGFGKFERSGHSHWCDKSDKDYWSKPLPPSECLE*VLFSGGNTGINFEKCDDIPIEATSSNCLPHIENFSNVDMGEIIVGNIELATCV
23 >lcl|XP_001096552.2|Plus1905066..906169 NW_001106347 tRNA-specific adenosine deaminase-like protein 3-like isoform 2 LOC709219 __SEG__ Chr19 {Macaca mulatta} MILCSRLCLPQSASLRMEPAPGLVEQPKCLEAGSPEPEAAPWQALPVLSEKQSGDVELVLAYAAPILDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLL
CLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVRAARRAAARGLRAVGAVVVDPAS
DRVLATGHDCSSADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYVCTGYDLYVTREPCAMCAMALVHSRILRVFYGAPSPD
GALGTRFRIHARPDLNHRFQVFRGVLEEECRWLDPDT*
24 >lcl|XP_001096594.1|Plus165104..65823 NW_001218145 mRNA turnover protein 4 homolog LOC703813 __SEG__ ChrX {Macaca mulatta} MPKSKRDKKVSLTKTANKGLELKQNLMEELRKCVDTYKYLFIFSVANMRNSKLKDIQNAWKHSRMFFGKNKAMMVAFGRSPSGEYKDNLYQVSKRLRGEMSFLFTNRTKE
EVNEWFTKYTEMDNTRAGNKAAFTVSLDPGPLEQFPHSMQSQLRQLGLPTTLKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKHMWDSQLGRFQHMGD
DLPESASESAEKSDSEDDD*
25 >lcl|XP_001097013.1|Plus1complement(1660858..1661085) NW_001120957 small nuclear ribonucleoprotein G-like LOC702298 __SEG__ Chr6 {Macaca mulatta} MSKAHSPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIMLEALERV*
26 >lcl|XP_001097137.1|Plus1complement(2472..2843) NW_001123636 RNA-binding Raly-like protein-like LOC707597 __SEG__ Chr8 {Macaca mulatta} MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLGKSCSDMDLMLLFIYLEIVLFLKTQ
NHCCFYLFFNQLE*
27 >lcl|XP_001097528.1|Plus1complement(2431709..2433349) NW_001111354 probable ATP-dependent RNA helicase DDX28 DDX28 __SEG__ Chr20 {Macaca mulatta} MALSRPVRLFSLVARLILAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRQRNLPRPVLVRPGRLLVSARRPEFNQPARLTLGRWESAPLASQGWKSRRARRDHFSIE
RAQQEAPAVQKLSSEGNFADLGLEPRVLHALQEVAPEVVQPTTVQSNTIPQLLRGRHVLCAAETGSGKTLSYLLPLFQRLMVQPSLDSLRIPAPRGLVLVPSRELAQQVQ
AVAQPLGRSLGLLVRDLEGGHGMCRIRMQLARQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDCILEKSHIADGPADLEDRFNPKAQLVLVG
ATFPEGVGQLLDKVASPDAVTTITSSNLHCIMPHVKQTFLRLKGADKVAELVHILKHHNRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRAGIF
QSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLVSSVKEPLPQQPDFDKSD*
28 >lcl|XP_001098283.1|Plus14928938..4929216 NW_001108982 putative small nuclear ribonucleoprotein polypeptide E-like protein 1-like LOC703285 __SEG__ Chr1 {Macaca mulatta} MVYYGQGQKVQKAVTEPIDLIFRFLQNRFQIQVWLYEQVNIWIEGCITGFDEYMNFVLVDAEEIYSKTKLRKQLGWIMLKGDNITQLHSVSN*
29 >lcl|XP_001098767.2|Plus1411546..412025 NW_001122921 hypothetical protein LOC710189 LOC710189 __SEG__ Chr8 {Macaca mulatta} MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPCPGMMPAPHMGGPPMMPMMGPPP
PGMMPVGPAPGMRLPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR*
30 >lcl|XP_001098770.1|Plus1complement(233794..234129) NW_001218176 serine/threonine-protein kinase PRP4 homolog LOC710193 __SEG__ ChrX {Macaca mulatta} MLKLAMDLKGKMPNKMTQKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVISTINPTKDLLADLIGCQRLSEDQHKKVHQLKDLLDQILMLDPVKRISINQALQHAFIQEK
F*
31 >lcl|XP_001099573.1|Plus15427519..5427875 NW_001218172 small nuclear ribonucleoprotein Sm D2-like LOC705126 __SEG__ ChrX {Macaca mulatta} MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRRDSVIVVL
RNPLIAGK*
32 >lcl|XP_001099845.1|Plus1201853..202161 NW_001114295 u6 snRNA-associated Sm-like protein LSm3 LSM3 __SEG__ Chr3 {Macaca mulatta} MADDVDQQQTTNTVEEPLDLIRLSLDERIDVKMRNDQELRGRLHAYDQYSNMILGDVEETVTTIEIDEETYEEIYKSMKRNIPMLFFRGDGVVLVAPTLRVG*
33 >lcl|XP_001099871.1|Plus18930066..8931928 NW_001124215 cleavage stimulation factor subunit 2 tau variant-like isoform 4 LOC703468 __SEG__ Chr9 {Macaca mulatta} MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPI
IDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQSVSVSGPGPGPGPG
PGPGLCPGPNVLLNQQNPPAPQPQHLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGPGPGSLTPGGAMQPQLGMPGVGPVPLERGQVQMSDPRAPIPRGPMTPGGLPP
RGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGSRDSRAMETRAMETEVLETRVMERR
GMETCAMETRGMEARGMDARGLEMRGPVPSTRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGAGMQGAGMQGAGIQGGGMQGAGIQGVGIQGG
GIQGASKQGGSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGTS*
34 >lcl|XP_001100343.2|Plus1320959..323271 NW_001111355 ftsJ methyltransferase domain-containing protein 1-like isoform 1 FTSJD1 __SEG__ Chr20 {Macaca mulatta} MSKCRKTPVQQLASPMSFSPDVLADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTEFNAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAEL
CTQAWCKFHEILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCDWSWVANTLNPYHEANDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQ
NFISSMATVHLVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGKEAIHPLL
PKMILNFGTEMKRKALFPHHVIPDSFLKRHEECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAVQYFMQKFQLKHLSRNNWLVKKSGIGCSTNTKWFGQRNKY
FKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSSILEGAASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCHVF
SEELIFSELCSLTKCLQDEQVVEPSNQIKCLLVGFSTSHNIKMHIPLEVRLLESAELTTFSCSLLHDGDPTYQHLFLDCLLHSLRELHTGDVMILPVLSCFTRFMAGLIF
VLHSCFRFITFFCPTSSDPLRTCAVLLCVGYQDLPNPVFQYLQSVNELLSTSLNSDSPQQVLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEIINSLQLQH
*
35 >lcl|XP_001100704.2|Plus1900707..901129 NW_001095149 NTF2-related export protein 1-like LOC711846 __SEG__ Chr10 {Macaca mulatta} MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFN
QNFILTAQASPSNTVWKIASDCFRFQDWAS*
36 >lcl|XP_001101394.1|Plus113343169..13343648 NW_001101665 hypothetical protein LOC706270 LOC706270 __SEG__ Chr15 {Macaca mulatta} MPKFYCDYCDTYLTHDSPSVRRTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPP
PGMMPVGPAPGMRPPMGSHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR*
37 >lcl|XP_001101468.2|Plus1complement(2676764..2678620) NW_001218128 eukaryotic translation initiation factor 4B EIF4B __SEG__ ChrX {Macaca mulatta} MVASAKKKKKKGKTIFLTDFLAEDGRTGRGSTYVSKPVPWADETDDLEGDVSTTWHSSDDDVYRSPSIDRSILPTAPRATREPNIDQSRLPKSPPYTAFLGNLSYDMTEE
SIKELF*GLNISAVPLPREPSNPERLKGFDYAEIEDLDSLLSSMSLNEESLGNRKIQVDVADQAQGKDREDRSFGHDRKRDSDKTDTDWRTPPATDSFDDYLPRRGDNSF
GD*YRDRCDSDRYHDGYRHG*RYGPHWDMD*YGSRDGYVDRGSRDYDRGYDSRIGSGRRAFDSGCGRDDDYRGGRNGYEDLYDR*DDQSWSSRDDYSRDDYMRDDRGLSQ
RPKLNLKPRSTPKEDDSSASTSQCSQGASIFGGAKHVDTATREREVEEQLQKEHEKLQR*LDEPKLERQPRERHPSWQSEETREREQSRTGSESSQTGTSATSGRNARRR
ERSH*KMKHSIRRKIVSL*LLNLPNLISP*R*RQPLHQRRMVG*SEVLNLLLNLRAQTQSSNPLQLVG*SSSSSTI*VRTSKER*KGSRWDECPKRPNWEL*PWSRRGRE
QRPLEGVR*ERWQKG*RLQICT*VKKT*GKSSFQVQFCKEVCCSLH*R*R*KRGR*LSRRDLDILCFIL
38 >lcl|XP_001103881.1|Plus1complement(21522..22076) NW_001121181 u3 small nucleolar ribonucleoprotein protein IMP3 IMP3 __SEG__ Chr7 {Macaca mulatta} MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRR
LPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA*
39 >lcl|XP_001105527.2|Plus1complement(3959316..>3959759) NW_001114287 hypothetical protein LOC715353 LOC715353 __SEG__ Chr3 {Macaca mulatta} CIGSPSSPHPVSEAAVDTGSEITTTDLQEKEVVEQAENGRDAAAIGNAKEENGEQEADNEVEEQEEEGGEEEEEEEEGDAEEEDGDEDEEAESATGQRAAEDDDDDVDTK
QQKTHGDDQTAEKEKLNYKKKKKAAVTCSPSTSRLRI*
40 >lcl|XP_001105963.1|Plus1complement(5038098..5038319) NW_001095180 NHP2-like protein 1-like LOC708283 __SEG__ Chr10 {Macaca mulatta} MAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV*
41 >lcl|XP_001106881.1|Plus1complement(13970619..13971581) NW_001101662 putative heterogeneous nuclear ribonucleoprotein A1-like 3-like isoform 3 HNRPA1 __SEG__ Chr15 {Macaca mulatta} MSKSESPKEPEQLRKLFIGGLSFETPDESLRSHFEQWRTLMDCVVMRDPNIKCCRGFGFVTYATVEEVDAAMNARPHKVDGRGVEPKRAVSREDSQRPGAHSTVKKVFVG
GIKEDAEEHHLRDYFEQRGKIEVIEIMTDRGSGKKKGFAFVTFDDHDSVDKTIIQKYHTVNGHNCEVRKAPSKQEMASASSSQRGRSGSGNFGGGRGGGFSGNDNFSRGG
NFSGCGGFGGSHGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRISGPYGGGGQYFAKPRNQGGYGSSSSSSSYGSGRRF*
42 >lcl|XP_001107362.2|Plus1<6..380 NW_001111394 RNA pseudouridylate synthase domain-containing protein 1-like LOC716566 __SEG__ Chr20 {Macaca mulatta} GDLTYGEPSGQEDRPFRMMLHAFYLRIPTDAECVEVCTPDPFLPSLDACWSPHTLLQPLDQLVQALRATPDPDPEDRGPRPGSPSTLLPGPGRPPPPPTKPPETEAQRGP
CLQWLSEWTLEPDS*
43 >lcl|XP_001107796.1|Plus1complement(4290725..4292509) NW_001108993 protein FAM71A-like LOC710735 __SEG__ Chr1 {Macaca mulatta} MNGDSLLPYYTAQSGSSMSMFNTTMGRLQRQLYKGEYDIFKYAPIFESDFIQITKRGEVIDVHNRVRMVTMGIARTSPILPLPDVMLLARPATGYEEYAGHGQATKRKKR
KAAKNLELTRLLPLKFVRISVHNHEKQQLRLKFATGRSCYLQLCPALNTRDDLFAYWEKLIYLLRPPMESNSSTCGIPAEDMMWMPVFQEDRRSLEAVDLQGKGDQDQVS
IRSLHMVSEVCGATSAAYAGGEGLQHDFHKPTNVLNVSIPKTSTELAEEPATGVTKEAAAAGAAAGAATGTVAGALSVAAANSAPGQVSVAIAGVATIGAGGSKSNMAIA
GTASMAPNSTKVAVAGAAGKSSEHVSSTSMSLSREGSMSLAIAGVELTSRTAAETDMDAAAGLPVSTRQSKSSLSGQHGRERTQASAEACKEGRERREKDKALGRSSRRR
RTGESRHKTRGDKIARKSSSRSSFSHRASRDDKKEKSCSSPGSSRHGESHKGVSHTPISKESRTSHKSGRSLSTTSSGSSKRLGRISSFLRNVRANLTTKAVGTPHGRDV
DIMAKTVERSTNVANAETAEGGQGLEMVGSMTPDIMETMTFETH*
44 >lcl|XP_001108236.1|Plus1complement(2871567..2871923) NW_001122890 small nuclear ribonucleoprotein Sm D2-like LOC711841 __SEG__ Chr8 {Macaca mulatta} MSLLNKPKGEMIPEELQKREEEEFNTSPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVL
RNPLIAGK*
45 >lcl|XP_001109022.1|Plus15020260..5021141 NW_001121200 heterogeneous nuclear ribonucleoprotein C-like 1-like isoform 1 LOC717494 __SEG__ Chr7 {Macaca mulatta} MASNVTNKTDPRSMNSHVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYDNERNARAAVAGENGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFD
LDYDFQRDYYDRIYSYPARVPPPPPIARAVVPSKRQHVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDRS
EEEQSSSSVKKDETNVKMESAGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS*
46 >lcl|XP_001109294.1|Plus1805..945 NW_001106657 u6 snRNA-associated Sm-like protein LSm7-like LOC717609 __SEG__ Chr19 {Macaca mulatta} PDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA*
47 >lcl|XP_001110880.1|Plus1complement(1194298..1194669) NW_001111169 u7 snRNA-associated Sm-like protein LSm10-like isoform 2 LOC713277 __SEG__ Chr1 {Macaca mulatta} MALSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGK
GQGRWEFPSKNYK*
48 >lcl|XP_001112234.1|Plus1complement(10241644..10242555) NW_001120983 heterogeneous nuclear ribonucleoprotein A0-like LOC713181 __SEG__ Chr6 {Macaca mulatta} MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVA
EGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSY
GGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF*
49 >lcl|XP_001112504.1|Plus118827056..18827286 NW_001112571 small nuclear ribonucleoprotein G-like LOC714757 __SEG__ Chr2 {Macaca mulatta} MNKAHSPELKKFMDKKLSLKLNGGRHVQGILQGFDPFMNLVIDECVEMAISGQQNNIGMVVIRGNNIIMLEALERV*
50 >lcl|XP_001114941.2|Plus1727..1089 NW_001101003 u4/U6.U5 tri-snRNP-associated protein 1-like LOC720002 __SEG__ Chr14 {Macaca mulatta} MGSSKKHRGEKEATGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAGEEAGP
AQGAGRAGVPE
51 >lcl|XP_001116262.2|Plus1complement(63..392) NW_001107199 ELAV-like protein 3-like LOC720637 __SEG__ Chr19 {Macaca mulatta} FSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA*
52 >lcl|XP_001116566.2|Plus1complement(<1048..1899) NW_001109946 probable ATP-dependent RNA helicase DDX59-like LOC720767 __SEG__ Chr1 {Macaca mulatta} MFVPRSLKIKRHANGDGKSCVAKIIKSDPEDLQLDKSRDAPVDALVTEAATTPDRHSSESCPFPSPGGQLAEVHSVSPEQGVKDSHPPEEPVKSFSKTQRWAEPGEPVCV
VCGRYGEYICDRTDEDVCSLECKAKHLLQVKEKEEKSKLSNPQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTRPIIDFEHCSFPEVLNHNLK
KSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMRALFEVSINNRVHMYYSWKQ
53 >lcl|XP_001117238.2|Plus1complement(117..449) NW_001112224 splicing factor 3B subunit 3-like LOC721174 __SEG__ Chr20 {Macaca mulatta} TKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISK
*
54 >lcl|XP_001117600.1|Plus114645940..14646134 NW_001096629 h/ACA ribonucleoprotein complex subunit 3 NOP10 __SEG__ Chr11 {Macaca mulatta} MFLQYYLSEQGDWVSTLEKFDPMGQQTCSALPAQFSPDDKYSRHRITIKKRFKVLMTQQLHPVL*
55 >lcl|XP_001117674.1|Plus1complement(1035..1271) NW_001115559 serine/arginine repetitive matrix protein 3-like LOC721504 __SEG__ Chr3 {Macaca mulatta} MSSTVNNGAASMPSPPDAANGFPQPSASSGAWPRAEEELRTAEPGLVKRAHREILDHERKRRVELKCMELQEMMEEQG*
56 >lcl|XP_002798798.1|Plus1complement(2547592..2548554) NW_001096637 putative heterogeneous nuclear ribonucleoprotein A1-like 3-like HNRPA1 __SEG__ Chr11 {Macaca mulatta} MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVAMRDPNTKRSRGFRFVTYATVEEVDAAMNARPHKVDGRVVEPKTAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKTVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGG
NFSGRGGFGGSRGGGGCGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGSYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
57 >lcl|XP_002799331.1|Plus1<8210213..8210593 NW_001099001 poly(rC)-binding protein 1-like LOC709520 __SEG__ Chr13 {Macaca mulatta} SPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQ
YLINARLSSEKGMGCS*
58 >lcl|XP_002799786.1|Plus13113799..3114026 NW_001100389 small nuclear ribonucleoprotein G-like protein-like LOC100430189 __SEG__ Chr14 {Macaca mulatta} MNKAHSPKLKKRMDKFSLKLNGGRYVQGILWGSSHFMNLMIDECVKMAISGQQNNIRTVEIEGNSIITLKALEQV*
59 >lcl|XP_002800714.1|Plus1complement(375..>1259) NW_001104226 Usher syndrome type-1G protein-like LOC100427371 __SEG__ Chr16 {Macaca mulatta} ELAERSDTLSFSSLTPSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERRKQGGEGTFKVSEDGRKSARSLSGLQLGNDVMFVRQGTYANPKEWGRAPLRDMFL
SDEDSVSRATLAAEPAHSEVSTDSGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGMGAPRGRLQSSPSLDDDSLGSANSLQDRSCGEELPWDELDLGLDEDLEP
ETGPLETFLASLHMEDFAALLRQEKIDLEALMLCSDLDLRSISVPLGPRKKILGAVRRRRQAMERPPALEDTEL*
60 >lcl|XP_002801311.1|Plus1639071..641200 NW_001106516 hypothetical protein LOC100430923 LOC100430923 __SEG__ Chr19 {Macaca mulatta} MSSPKRSSKPSMSPAPSGSSMPTADPKPPASLKSTKSATPNRSLVPTKPATSPNLVVSPSSSKSTKSTSTKRAPSNLPSSRSRVHSKARTPSRVSTDTRTSKASKASKAS
KASGVRCHQRKGTHSRGRTPGRRGSRSSKRSPSRASTPGRIRTHGARPAMASRVRTPTSQQKRSRGKSYGRPRTSNRERSDSQPRNMSKKSYRPPGGSGMGRSSELAVTP
STAKCQTLTGIPSKEKSDSPSPSSSRKVKSYGQMIIPSREKSYSPTETSSRVKSYNQASTHSRPQSHSQSRSPRRSRSGSQKRTHSRTRSHSWKRNHSRARSRTRKGILS
QTGRHSQSRTHSKGKSQNQPRTPRRGRSHNWSRNPSEERSHSHSRSFSKDRDRRGSSSPRKENGHSQSGSPNKQRDRSPSRSPKKERDHSRSRSPNKARDHSRSRSPSKE
RDHSQLGSPSKERDRSRSRSPSKERDHRRSRSPSKEKYHGRLGSLNKERDHSQSRSPSKEKEHRQSRSPSKERDCRRWRSPSKERERRQSRSPSEEKEHRQSRSPSKERD
HRRWRSPSKERERRQSRSPSEEKEHRQSRSPSEERDHSRSRSPSRQSGYRQPRASSKEKAHSRSRTPSKEGNHSQSRTSSKERDPSQSTVPRSPDWKRSPTRTRSLSQNR
TPSKTSSHCPSTFPNGGQTLSKDDSQANATTSKATLPGERSSSSSSKLA*
61 >lcl|XP_002803238.1|Plus1complement(253855..255768) NW_001114189 poly(A) polymerase beta-like LOC100429853 __SEG__ Chr3 {Macaca mulatta} MMPFPVTTQGPPQQAPLPKCYGISSPISLAVPKETDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESKSLPQSVIENVGGKIFTFGSYRLGVHT
KGADIDALCVAPRHVDRSDFFTSFYVKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDN
FRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
SVSTRMVMIEEFKQGLAITHEILLSKAEWSKLFEAPSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENPDMEEFRTMWVI
GLVLKKPENSEILSIDLTYDIQSFTDTVYRQAMNSKMFEMGMKITAMHLRRKELHQLLPHRVLQDKKAHATEGRRLTDLNDSSFDLSAGCENSMSVPSSTSTMKTGPLIS
SSQGRNSPALAVMTASMANVQATEISLQQMNTSESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL*
62 >lcl|XP_002803583.1|Plus1174909..175562 NW_001114297 hypothetical protein LOC716393 LOC716393 __SEG__ Chr3 {Macaca mulatta} MTHRKWQLLSIYLSDREERERRGRDTERGRERRRERQREGGRERERERALSWLQTPLVGEKLRRPKVWPTPGLPLAARPPRCSRAMARAGVDAGLGEEGAHGREPHLPGG
LLGCFLWEQLVHVPARPSPSGIRRGFSWTLWPPPPPRARVKEHPSPLVTETKRSGPSRQVKVQDAASPRLLPEGGVEPPRAPDRAAARGLCGLFPSPPSADQSRKFA*
63 >lcl|XP_002804466.1|Plus15346320..5346799 NW_001120973 hypothetical protein LOC100430762 LOC100430762 __SEG__ Chr6 {Macaca mulatta} MPKSYCDYCNTYLTHDSPSVGKTHHSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPAPSSAPPPAGAMIPPPPSLPSLPHPGVMPAPHMRGPPMMPMMGPPP
PGMTPVGPAPGMRPPMGGHRPMMPGPPMMRPPAGPMMVPTWPRMTRPDR*
64 >lcl|XP_002804525.1|Plus1complement(452568..453095) NW_001120980 survival motor neuron protein-like LOC100424620 __SEG__ Chr6 {Macaca mulatta} MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKNKSQKKNTAAPLKQPGLKFNGPPPPPPPPPPHLL
SCWMPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN*
65 >lcl|XP_002805610.1|Plus12591733..2592581 NW_001124105 ribonuclease P protein subunit p38-like LOC100429345 __SEG__ Chr9 {Macaca mulatta} MAAAPQAPGRGSVRKTRPLVVKTSLNNPYTICWSPLESEDRHFILQTLEDRLKAIGLQKIEDRKKKNKTPFLKKESREKCSNAVDISEDLKEKTDAKQQVSGWTPAHIRK
QLAIGVNEVTRALERSELLLVLVCKSVKPAIITSHLIQLSLSRTVPACQVPQLSERIAPVIGLKCVLALGFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRTEDSGESLET
EPLESQDKELLDTSFEDLSKPKRKLADGQQASVTLQPLKIKKLIPNPNKKRKPPKSKKATPK*
66 >lcl|XP_002805665.1|Plus1complement(395470..396717) NW_001124197 heterogeneous nuclear ribonucleoprotein F-like isoform 2 HNRNPF __SEG__ Chr9 {Macaca mulatta} MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSAND
GFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD*
67 >lcl|XP_002806331.1|Plus1<95362..96111 NW_001218141 polyadenylate-binding protein 1-like 2-like LOC705906 __SEG__ ChrX {Macaca mulatta} AAGTPLGEADADADANEGVAAAVASAAAAADADADAETRGGCEGNPDFPMASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALE
TLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHKERE
AERGAWARQSTSADVKDFEEDTDEEATLR*
68 >lcl|XP_002806350.1|Plus1<1157981..1159237 NW_001218164 DDB1- and CUL4-associated factor 13-like LOC698056 __SEG__ ChrX {Macaca mulatta} YDPTLHPFEVPREYVRALNATKLERVFAKPFLASLDGHRDGVNCLAKHPKNLATILSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWK
MDGPGYGEEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPVETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWN
PMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFNKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANAS
EKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPIVSEKKKHIVAVVK*