SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom A    

ID / Description / Sequence
1 >lcl|XP_001362231.1|Plus1complement(557824..559008) NW_001587040 putative RNA-binding protein Luc7-like 2-like LOC100010241 __SEG__ ChrX {Monodelphis domestica} MSAHAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAE
TQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIE
IREKLQELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHRSRSTSQDRKRTRSKSHEKRHRHRSRSSSHSHQRSGHSSRDRSKEKSKRRS
SKERSSGDKERLRDQDLASYDKNRRSRDWSPRDREKRDKKRSYESANGCSEDRRSSEEPEAGEI*
2 >lcl|XP_001362315.1|Plus1959793..961544 NW_001587040 RNA-binding protein 47-like isoform 1 LOC100010323 __SEG__ ChrX {Monodelphis domestica} MTADSATKMSNDSTNAAAAKAPEGVAGAPNEAALLALMERTGYSMTQENGQRKYGGPPPGWEGLHPPRGCEVFVGKIPRDVYEDELVPVFESVGRIYQMRLMMDFDGKNR
GYAFVMYTHKREAKRAVRELDNHEIRPGRPLGVCCSVDNCRLFIGGIPKMKKRDEILEEISKVTEGVLDVIVYASATDKTKNRGFAFIEYESHRAAAMARRKLMPGRIQL
WGQQIAVDWAEPEMDVDEDVMETVKILYVRNLMIKTSEETIRKTFSQFGCVERVKKIRDYAFVHFTSREDAIRAMNSLNGTELEGSCLGVTLAKPVDKEQYARYRKAVKG
SVTAEVQQLNYVYSCDPYTLAYYSYPYSALFGPNRDYFVKAESVRGRGQDTAGSRAPGPRGSYFGGYSAGRGIYSRYHEGKGKWRERGYEFVPNLELSAANPVPIKPGTV
AIPALGAQYSMFQAGPAPKLLEDGKMHAMEHMINPIAVQADPAGASAAAAAATIPAGSTPPPFQARPITPVFTGAPNVQRIPAAGLYGAGYIPFAAPASATSATVQKSAA
ATAPVYGGYGGYIPQPFPSATIQPPIHEDYQTY*
3 >lcl|XP_001362328.1|Plus1complement(329977..330393) NW_001581957 u1 small nuclear ribonucleoprotein C-like LOC100009821 __SEG__ Chr4 {Monodelphis domestica} MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVRDYYQKWMEEQAQSLIDKTTTAFQQGRIPPNLFSAPPLGGPMIPPPHPSMMGPPPPGMMPVGPPPGMRMPMGGHMP
MMPGPPMMRPLPHPMMVPTRPVMPRPDR*
4 >lcl|XP_001362487.2|Plus1245573..247549 NW_001581842 hypothetical protein LOC100009887 LOC100009887 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQRESQKSPEWSRELTPEPPGSPMSTEPCGSPREQTAVGERRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTLGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRGSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARDVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
5 >lcl|XP_001362567.2|Plus1249523..251499 NW_001581842 YTH domain-containing protein 1-like LOC100009931 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQRESQKSPEWSRKLTPEPPGSPMSTEPCGSPREQTAVGKRRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTLGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRRSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARGVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
6 >lcl|XP_001362659.2|Plus1253483..255459 NW_001581842 hypothetical protein LOC100009979 LOC100009979 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQPESQKSPEWSRELTPEPPGSPMSTEPCGSPREQTAVGERRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTLGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRRSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARGVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
7 >lcl|XP_001362747.2|Plus1257442..259418 NW_001581842 YTH domain-containing protein 1-like LOC100010025 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQRESQKSPEWSRELTPEPPGSPMSTEPCGSPREQTAVGKRRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTVGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRRSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARGVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
8 >lcl|XP_001362774.1|Plus14759242..4760927 NW_001581868 heterogeneous nuclear ribonucleoprotein Q-like LOC100011343 __SEG__ Chr2 {Monodelphis domestica} MATEHVNGNGTEEPMDTSSAVTHSEHFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGT
KVADSSKGPDEAKIKALLERTSYTLDVTTGQRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAV
KLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPD
PEVMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMP
PPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRVRRAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGG
KGVEAGPDLLQ*
9 >lcl|XP_001363061.1|Plus116010351..16011922 NW_001581968 u4/U6 small nuclear ribonucleoprotein Prp4-like LOC100011307 __SEG__ Chr5 {Monodelphis domestica} MASSRASATATKTPTRTPEDTASPVVKKPHIYYGSLEEKEKERLARGESGLLGKEGIKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVK
ACLRALEEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGSNNLKTARLWIANYSLPRAMKRLEEARLHKEIPETSRTSQKQELHKSLR
SLNNFCSQIGDDRPISYCNFSPNSKLLATACWSGLCKLWSVPDCSLLHTLRGHNTNVGAIVFHPKSTVSLDKKDVNLASCAADGSVKLWSLESDEPVADIEGHSVRVARV
MWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQR
RCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE*
10 >lcl|XP_001363668.2|Plus1complement(2175967..2177076) NW_001587039 CCR4-NOT transcription complex subunit 7-like LOC100010526 __SEG__ ChrX {Monodelphis domestica} MPAAHAEQSPRIREVWACNLDEEMKKMRPVIQQYNYVAMDTEFPGVVARPVGEFRSYADYQYQLLRCNVDWLKIIQLGLTFMNEQGECPPGTSTWQFNFKFNLKEDMYAQ
DSIELLTMSGIQFKKHEEEGIEAQYFAELLMTSGVVLCDEVKWLSFHSGYDFGYFIKILTNSPLPEEAHDFFEILKLFFPVIYDIKYLMKSCRNLRGGLQEVATQLELER
IGAQHQAGSDSLLTGMTFFKMREMFFEDHIDDAKYSGYLYGLGSGATHAYSNSWRRSHNIVQNSTQNSIQNSYPNTGQSSFQNTVQCNFPNGYLSSYQSSFQNYHNSFQN
GYQNSFLNSIPDIQNIQYVQYVQYGREPVWRGDQPAFLR*
11 >lcl|XP_001363707.1|Plus19766786..9768201 NW_001581965 heterogeneous nuclear ribonucleoprotein K-like LOC100012358 __SEG__ Chr5 {Monodelphis domestica} METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEE
GLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKG
RAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPG
DRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQVEYHEFTGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDR
IITITGTQDQIQNAQYLLQNSVKQYADVEGF*
12 >lcl|XP_001364116.1|Plus1complement(8300443..8300637) NW_001581928 H/ACA ribonucleoprotein complex subunit 3-like LOC100015275 __SEG__ Chr4 {Monodelphis domestica} MFLQYYLNEQGDRVYTLKKTDPAGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQARLVL*
13 >lcl|XP_001364499.1|Plus1complement(1530373..1531587) NW_001581894 lupus La protein homolog LOC100014953 __SEG__ Chr3 {Monodelphis domestica} MAENGDSEKMTDLESKICQQIEYYFGDFNLPRDKFLKEQIKIDDGWVPLEIMIKFNRLSKLTKDFDVIRSALKKSKAELMEVSEDKTKIRRFPSKPLPEVTDEYKNEVKN
KSIYVKGFPTDATLDDIKEWLEGKGQVQNIQMRQTLHKAFKGSIFAVFDSVESAKKFIETPGQKYKDTELLILFKEDYFAKKNEERKQNKVEAKAKAKQEQEEKQKQAEE
PELKSLDEKIGCLLKFSGDLDDQTCRDLHTLFSNHGEIKWIDFIRGAKEGIILFKEKAKEALEKVNEANSGNLKLRNKDVTWEVLEGEKEKEALKKIIEDQQESLNKLKS
KGRKFKGKVRGGKAVQGTPNKGKMQFQGKKTKFDSDEEQENGDAGGSLKRTREEPENEEPAPKQLKTENGAGDQ*
14 >lcl|XP_001364500.1|Plus1complement(4568628..4570520) NW_001581897 polyadenylate-binding protein 4-like LOC100013558 __SEG__ Chr3 {Monodelphis domestica} MNTAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSI
DNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGDDMDDGRLKELFSKYGKTLSV
KVMTDPSGKSKGFGFVSFEKHEDANKAVEEMNGKDINGKMVFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDG
RSKGFGFVCFSSPDEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMRALPANTIINQFQPTPGGYFMPAVPQAQNRPPYYAPNQIAQMRPNPRWQQG
GRPQGFQGVPNTIRQSGPCPALRHLTPASNTQASRGLPTTPQRVGVPTAVQNLSPRPSVATPAPRAVPPYKYAANVRSPHPAIQPLQTPQPAVHVQGQEPLTASMLAAAP
PQEQKQMLGERLFPLIQTMHNNLAGKITGMLLEIDNSELLHMLESPESLRSKVEEAVAVLQAHHAKKEAAQKVAVVAATS*
15 >lcl|XP_001365566.1|Plus127556429..27557706 NW_001582021 polyribonucleotide 5'-hydroxyl-kinase Clp1-like LOC100017655 __SEG__ Chr8 {Monodelphis domestica} MAEESNDEKKPLAKFELERETELRFEVEASQSAQLELLAGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAERE
EERGPRVMVVGPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSIQAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRR
ASVSGCVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRREYRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVG
APTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENISETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIRFMDLK*
16 >lcl|XP_001365833.1|Plus1complement(19814873..19815427) NW_001581855 u3 small nucleolar ribonucleoprotein protein IMP3-like LOC100018219 __SEG__ Chr1 {Monodelphis domestica} MVRKLKFHEQKLLKKVDFLNWETTDHNLHELRVLRRYRLERREDYTRYNRLSRTVRDLARRLRDLPENDPFRVQASAALLSKLYAMGLVPTQSSLQLCDSVTASSFCRRR
LPVVLVKLRMAQHLRAAVTFVEQGHVRVGPHVVTDPACLVTRAMEDFITWVDSSKIKRHVLNYSNERDDFDLDA*
17 >lcl|XP_001365962.1|Plus1complement(68319555..68322038) NW_001581900 tuftelin-interacting protein 11-like LOC100017285 __SEG__ Chr3 {Monodelphis domestica} MSLSHLYREGKGAIDEEEDEMENFEITDWDLQNEFNPNRQYHWQTKEEATYGVWAEHEREDEQPGYGGKRSRDFLAPVNFISAGLKKADEEDSNEDKKPIKQLDFPKDFG
PKKLQTGGNFKPSQKGWVGGAKSFTGLGSWERHTKGIGQKLLQKMGYVPGKGLGKKAQGIIHPIEAKGRKGQAAGGASGSEGTAQSVQDFPGLDSEEEEVQKELSQRWKD
LSGGRKKPKYSSQTVEELKAKGRIGKKLSAPQKELSQVKVIDMTGREQKVYYGYSQISHKHNIPEDGLQQQQLPLSGKHAKPQAFALPELEHNLQLLIDITEQEIIQNDR
QLQEESDKVHNLSHELGKMSEVLSHEETVITNLRKVLEMVEECERRTQPDCSDPLTLDECARIFETLQEKYYEEYRMSDRVDLAVAIVYPLVKDYFKAWDPLKDCTYGTG
IIAKWKSLLTNDQILSHGGQDLAADAFHRMIWEIWMPFVRNTVPQWQPRNCDPMVDFLDSWVHIIPVWILDHILDQLIFPKLQKEVESWNPLTDMVPIHSWIHPWLPLMQ
SRLEPLYSLIRNKLSRALQKWHPRDSSAKLILQPWKDVFTPGSWEAFMVKNIVPKLGMCLNEFIINPHQQHMDAFYWVIDWEGMISVSSLVGLLKKHFFPKWLHVLCSWL
SNSPNYEEITKWYLGWKSMFTDQVLAHPSIKDKFNEALDIMNRAVSSNVGAYMQPGARENIAYLTHTERRKGFQYEAMQHCREAENMAQRGIGMAASSVPMNFKDLIQTK
AEEHNIVFLPVVGKRHEGKQLYTFGRIVVYIDQGVLFVQGAKTWVPTSLQSLIDMAK*
18 >lcl|XP_001367135.1|Plus1complement(3387649..3389802) NW_001587047 cleavage stimulation factor subunit 3-like LOC100012775 __SEG__ ChrX {Monodelphis domestica} MFVNGASEHIAEYIPEKVKKAEKKLENNSYDLTAWSILIREAQSQSVEKARKTLERLVAQFPSSGRFWKLYIEAEIKTKNFDKAEKLFQRCLIKVLHIDLWKCYLTYIRE
TKARLPSFKEKMAQAYDFTLDKIGMEIMSHQIWMDYINFLKGVEAIGSYAENQRITAVRRVYQRGCVNPMINIEQLWKDYNKYEEGINIHIAKKMIDDRSRDYMNARRVA
KEYETVVKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKNNPLRTEDHTLITKRVIFAYEQCLLVLGHHPDIWHEAAQYLEQSSKLLAEKGDMNNSKLFSNEAANIYER
AISSLLKKNMLLYFAYADYEESRMKYEKVHSIYNRFLVIEDIDPTLVYIQYMKFARRAEGIKAGRMVFKRARGDTRARYHIYVAAALTEYYCSKDKIVAFKIFELGLKKY
GNIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGVLPPDKSGEIWARYLAFESSFGDLVSILKVEKRLFTAFKEEYEFKETALRVDRYKFLDLYPCRASELKAFGYKDVS
RTKLGIIIPDPMVTPSVVSVLKNEEDRKPKYPRPDVRQMIPFQPRHFASPGLHPVSGGVFPVPPAAVLLMKLLPPPVCFQGPFVQVDELMEIFRRCEIPSTLDEAVKIIT
GRVPYRARDRNSFLESSSTVKRVAKRPNEDMNEEGGKHKARPPVHDIYRARQQKRIR*
19 >lcl|XP_001367420.1|Plus1complement(1452977..1454884) NW_001587040 polyadenylate-binding protein 1-like LOC100013031 __SEG__ ChrX {Monodelphis domestica} MHPSAPSYPTASLYVGDLHPEVSEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALETMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSI
DNKALFDTFSAFGNILSCKVVCDEHGSKGYGFVHFETRDAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDLRLKRLFGKFGPSLSV
KVMTDESGTSKGFGFVNFERHEDAQKAVEEMNGKELNGKKIYVGRAQKKGERQTELKRKFEQLKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGG
RNKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYIALAQRKEERQAHLTNQYMQRMASIRAVPNPVLNPYQPPSGYFMTAIPQTQNRPAYYPASQMAPLRPSPRWTSQGA
RPHPFQNLPGAIRPAASRPPFGSMRPMSSQLRGVGASQRIANSSTQALGLPPGASAGAAGAPGVRMGPQYKYAAGVRNPQQHVNIQPQARVQQPAVHVQGQEPLTASMLA
AAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVKNAADVPAV*
20 >lcl|XP_001367568.1|Plus180863929..80864399 NW_001581902 nuclear cap-binding protein subunit 2-like isoform 1 LOC100020122 __SEG__ Chr3 {Monodelphis domestica} MSGGLLIALQSDSYVELGWYRDQQFRGKMEDQEKLLKKSCTLCVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKVKKTACGFCFVEYYCRADAENAMRYINGTHLDDRI
IRTDWDAGFREGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKTVQNQ*
21 >lcl|XP_001367656.1|Plus1complement(80932264..80932734) NW_001581902 nuclear cap-binding protein subunit 2-like isoform 1 LOC100020149 __SEG__ Chr3 {Monodelphis domestica} MSGGLLIALQSDSYVELGWYRDQQFRGKMEDQEKLLKKSCTLCVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKVKKTACGFCFVEYYCRADAENAMRYINGTHLDDRI
IRTDWDAGFREGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKTVQNQ*
22 >lcl|XP_001367778.1|Plus1complement(8724834..8725541) NW_001581876 serine/arginine-rich splicing factor 7-like LOC100019033 __SEG__ Chr2 {Monodelphis domestica} MSCYGRYGGETKVYVGNLETGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVQGLDGKVICGSRVRVELSTGLPRRSRYDRPPARCPFDPNDRCYECG
EKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRPRSASLRRSRSASIQSRSGSLKRSRSSRSRSRSRSRSLSRPRSSQSKSRSPSPKRSHS
PSGSPRRSASPERMD*
23 >lcl|XP_001369055.1|Plus1complement(62237540..62239045) NW_001582021 splicing factor 3A subunit 3 SF3A3 __SEG__ Chr8 {Monodelphis domestica} METILEQQRHYHDEKERLVDVMAKEMLIKKSTLQDQINSDHLMRAMQVRYMEASGKLRDLYNDKDGLRKEELSAISGPNEFAEFYNRLKKIKDFHQKHPKQICVPMSVEF
EELLKARENLSEEAQNLVEFTDEEGYGHYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQKEFEKK
WDNGTFPGWPKETSSALTHAGAHLDLSTFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDSSLFAKNSKSKGTKRGTERNKDIAFFEAQIYEY
VEILGEQRHLTRENVQRKQAQTGEERMGEEEEEISESESDNEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYQGPKAFQRHFAEWRHAHGMRCLGI
PNTAHFVHVTQIEDAISLWGKLKLQKVSEQWQPDMEEEYEDSRGNVVNKKTYEDLQRQGLL*
24 >lcl|XP_001369086.1|Plus1complement(62292602..62293630) NW_001582021 pre-mRNA-splicing factor 18-like LOC100022566 __SEG__ Chr8 {Monodelphis domestica} MEKLKAEIGQKRKLVEDQNLLGERKKYFKRSDLAKKEEEAYFERSGYKVQPKEKDQKPLPSPNPVLEVEPAEGKSPVTLSRPQVLRQFRERGEPVRLFGETDYDAFLRLR
KIEILTPEVNRGLRNDLKAALDKIDQQDLDEMASGQEPGENDTQNDLKVHEENTTFEELEALGKSLGKGDDQEDMDIITKVLKFLLGVWAKELNAREDHVKQSVQGKLNS
ATHKQTEAYLRPLFRKLQKRTLPADIKESITNIIKFLLQREYVKANDAYLQMAIGSAPWPIGVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFS
TDPSKCVEYNAL*
25 >lcl|XP_001369610.2|Plus13673427..3673627 NW_001581931 zinc finger protein 593-like LOC100015580 __SEG__ Chr4 {Monodelphis domestica} MARSRRTGAHRAHSLARQLKAKRRRPDLDEIHRDLKPHSAARQAQPDAEPDPDLPGGGHHRCLACA*
26 >lcl|XP_001369957.1|Plus17942052..7942996 NW_001581959 WD repeat-containing protein 82-like LOC100015998 __SEG__ Chr4 {Monodelphis domestica} MKLTDESLRSFRVAKVFQENSDKINCFDFSPNGQAIISSSDDDSIVLYDCGEGRPKRTLYSKKYGVDLVRYTHAIDTALCSSNKIDDTIRYLSLKYNKYIRYFPGHDKKV
VALSMSPADETFISASLDKTIRLWDLRVPNCQGLMYLQGKPVCAFDPEGIIFAAGVNSEIVKLYDLRAFDKGPFANFEIQQDKTCEWTGLKFSNDGKRILISTNGSFIHL
IDSFRGVVIHSFRGYNNSKAVALESSFTPDSQFIMTGSDNGKIHVWNGESGVKVAVLNGKHTGPITCLQFNPKFMTFASTCSNMVFWLPTIDDS*
27 >lcl|XP_001371131.1|Plus17697033..7698433 NW_001581928 heterogeneous nuclear ribonucleoprotein H-like LOC100017632 __SEG__ Chr4 {Monodelphis domestica} MMLNTKGEEGFVVKVRGLPWSCSASDIQQFFSECKILNEEAGIHFVYTREGKLSGEAFVELKSEDEITLALKKDRETMGHRYVEVFRSSNIEMDWVLKHTAPNSLDTASD
GFVRLRGLPFRCNKEEIVQFFSGLEIMPNGITLPVDFQGRNSGEAFVQFASQEIAEKALKKNKETIGHRYIEIFKSSQAEAQTYYDFPRKLMARHRPGPYDRPQAGRGYS
TLGRGVGFAGMRCGAYEAGYRGYDDYNWYNDDYCFGRYLNLEMSDHSYGDSWSTFNQSPAGHYVHMRGLPYKATENDICDFFSPLKPVGAYIEIGPDGRVTGEADVEFAT
HEDAVAAMSKDKANMQHRYIELFLNSTIEADSNVYDPQMGGGMSLLNQSTYGIPPNQELNEGYGGVSEGHISMNKYDQVLQENFSNFSSPHGTENQGEVNNGYNNWGSFA
DMGENRMGEISGISNMGSECGRYPDY*
28 >lcl|XP_001371322.1|Plus1complement(155439841..155440311) NW_001581879 nuclear cap-binding protein subunit 2-like isoform 1 LOC100027785 __SEG__ Chr2 {Monodelphis domestica} MSGGLLSALQSDSYVELGWYRDQHFRGKMDDQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKVKKTACGFCFVEYYCRADAENAMRYINGTRLDDRI
IRTDWDAGFREGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKIVQNQ*
29 >lcl|XP_001371380.1|Plus17838367..7839773 NW_001581928 heterogeneous nuclear ribonucleoprotein H-like LOC100017995 __SEG__ Chr4 {Monodelphis domestica} MMLSTKGEEGFVVKVRGLPWSCSASDIQQFFSECKIQNGAAGIHFIYTREGRPSGEAFVELESEDEVTLALKKDRETMGHRYVEVFKSNNIEMDWVLKHTAPNSLDTASD
GFVRLRGLPFRCNKEEIVQFFSGLEIMPNGITLPVDFQGRNSGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSQAEAQTHYDPPRKLMAKQRPGPYDRPQAGRGYS
TLGRGVGFAGMRCGAYEAGYRGYDDYNWYNDDYCFGRYLNYYLAMSGHSYGDSWSTFHQSPAGHYVHMRGLPYKATENDICDFFSPLKPVGAYIEIGSDGRVTGEADVEF
ATHEDAVAAMSKDKANMQHRYIELFLNSTTEADSSAYDPQMRGGMSLLNQSTYGTPPSQELNEGYGGVSEGHISMNKYDQVLQENFSNFSAAHGTENQGEVNNSYNNWGS
FAYMGENRMGEIAGISNMGSECGMYPDY*
30 >lcl|XP_001371554.1|Plus1158185146..158185799 NW_001581879 zinc finger CCHC-type and RNA-binding motif-containing protein 1-like LOC100028090 __SEG__ Chr2 {Monodelphis domestica} MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKESAQNCSRALNNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSQCYEC
GETGHLSYACPKNVLGERDPPKKKEKKKRKKIIKLEEEIEEVDKSEGEGEDPALDSLSQAIAFQQAKIEEDQQRWKPCASEPSTSDDSRRPRIKKSAYFSDEEELSD*
31 >lcl|XP_001371730.2|Plus13275420..3276448 NW_001581906 tRNA-specific adenosine deaminase-like protein 3-like LOC100018548 __SEG__ Chr3 {Monodelphis domestica} MEHNPVPWQILPVLSDQQSQGVELVLAYAVPILDKKKTSSLVKEISSVYPLEGQQHLKRVRACTDKTSPHPLEMLICLAKPGKEKAEDLQILSDLLSNKQIDCHGLGEPF
LVHVPAHPPLTRMQFEEAKFHWPTAFHEDKHVTSALTGDLFSKEEKVKMQAYMEQAIWAAQQGAEKGMKSIGAVVVDPATETVLAVGHDCRSASNPLLHATMVCIDLVAQ
GQGRGTYNFKSYPACTVSPLGNRDLSASKSIRAGTIRKLESRDDELPYICTGYELYITSEPCVMCAMALVHSRIQRVFYGIASPDGALGTKYKIHTRQDLNHRFEVFRGI
LEDRCYSLIKDS*
32 >lcl|XP_001371739.1|Plus13966906..3968888 NW_001587048 nuclear RNA export factor 1-like LOC100018560 __SEG__ ChrX {Monodelphis domestica} MADQGKPEGKSRGKSENKSYGELGAGGSSCSENSSAQRLKKSRGGSLRRKYHSESKSSSSSSSGSRGYSQGPPRSAREDRDDPFEGQEASRARYSPHRSRIERGKWWERG
GSRIHATVKRREREKERERHSLDRGVALSNQIPLSKQWFKVTISNGRNYDKTWLLSTLRGKCNVALNPVDFHYDDKKALFFVEDPHIASALKAADHNIVDGDNRRISIVV
NTSSPPYSVQNELKPEQLEQLKIVMSKRYDNAKKTLSLKGLRSEPDLMIQCIDIVLNRKNYMTALVQIIGENIPELLSLNLSNNRIYKLDDFADIVHKAPNLRSLNLSCN
ELKSERELDKVKELKLDELWLVGNPLCKSFRNRASYLTAIRERFPKLLRLDGHDLAPSVALNAQTRPPVALNVEMPALLPACKGSFFGSETLKGMVTYFLQQYFSVYDSG
DRQGLLDAYHEEACCSLSISANIQNPSQYNMSEYVKDNRNVKKVKDPGLRFHLLKHSRLAVITFINELPKTQHDMSSFVVDVCAQTETLLCFSVHGLFKEVEEKSNAIRA
FTRMFIAVPSNNATRMCMVNDELFVRNANPEEIHRAFAAVPAPPTSSFISMVNIFQEQQSIIQLFSTQSGMNLEWSKKCLQDNNWDFPRAAQIFTQLKVEGKIPAVAFQK
*
33 >lcl|XP_001372146.1|Plus18017913..8018335 NW_001581980 NTF2-related export protein 2-like LOC100019223 __SEG__ Chr6 {Monodelphis domestica} MAVTSSVDFKTYVDQACRAAEEFANIYYDTIDKRRRVLTRLYLDSATLIWNGNAVSGQDALNEFFEMLPSSEFHINVLDCQPVHEQATQSQTTILVVACGTVKFDGNKQR
YFHQNFLLTAQVTPNNTVWKIASDCFRFQD*
34 >lcl|XP_001372905.2|Plus1complement(22844845..22845933) NW_001581868 heterogeneous nuclear ribonucleoprotein H-like LOC100020384 __SEG__ Chr2 {Monodelphis domestica} MKKQSQWIGPGYNEGFSWNNVEMIQVFNRASPDGSLIANGGLLCIRGLPFGCNKETIRHFFSGLETVPSGIILPVDFQGKSTGTALVQFASQEAAEIAIRKHKGRPEPRY
LENLKNGSVPMPTHWGPFRAFVVKQRLGPYDRQGPELRLKTVSGEGSDKGMRPRVFERLNGSYICKNRSNDDPSIDFNISTRRIPNNRFGDFIFHNATCHHWVHMRGLPY
KATVNDIYHFFSPLCPLRVHIEIGEDGKATGEADVDFVTHEDAVAAMVKEKTYMQHRYIELFLYSTAKGRMDAFTSKVLKARENQLRGNPFERQQPNMRCNIRSGLKNSL
GGGSMSQEMMNGHCFSKGNIVCMRVKDISNMC*
35 >lcl|XP_001373103.1|Plus1579956..582784 NW_001587044 polyadenylate-binding protein 1-like LOC100020697 __SEG__ ChrX {Monodelphis domestica} MASRRTSDAKADAAKGSGDHVFLTGENPSAAVAFGIPGAPGEPGGPGGPGEPRGPRGPSGPLEPGGQSASYSTEVMEVKPSSTVGVSKPIEMIEQSKPIEIMGSSDEIEP
MGQNEPMMGPVMGPNEPVTGFNVPGMGSNETVMGLNAPMMSQNEPVMGRNETVMEPKESILGLKETVMGSVQSGPSGETELKMQIEESKQSEIKEQNVPDEPGEASGQTK
AVELSEVVVASEVRGPFEARGPPEMNISGPFEASGLLGACGPLGASGPLGASGPLGAGGPLGAGGPLGASGLLGAGGPLEASGPLDVSGATAIPMASLYVGDLHHDVTEA
MLYEKFSPAGPILSIRVCRDMLTRRSLGYAYVNFQQLADAERVLETMNLDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLEKSIDNKALYKTFSAFGNILSCKVISDEN
GSKGYGFVHFENQQAADKAIEKMNGVRLNNLKVYVGRFKSRKERELELGARAREFTNVYIKNFGEDMDNDRLTEVFGKFGHALSVKVMTDESGKSKGFGFVSYEKHEDAQ
RAVDEMNGKEFNGKRIYVGRAQKKGERQTELKRHFEQVKQERSSRYQGVNLYVKNLDDSIDDERLRKAFSPFGTITSAKVMMEGGHSRGFGFVCFSAPEEAAKAVSEMNG
KLVATKPLYVALAQRKRDRQVHLTNQYMQRMASFQAMSNPVFSPYQPPPTSRYFMTPLPQPQSRPAYYPYGQIPQFRPSPPHWAVPGGRFHPFQTVPGVMRPRGPAPAPA
PAPFNPVTSSSVPVSALMNTQHIVNPSSQMLGPPNPPFMPPMRSVQQYKYAAGVRNPKHLNMPLPVTTPQPAGLFEFQEPLTASMLAATPPQEQKQILGERLFPLIQALN
PALAGKITGMLLEIDNSELLHMLESPESLQAKVDEAVAVLEAHQAKEAAEKKGDTDPKMPPD*
36 >lcl|XP_001374016.1|Plus1complement(30920688..30921104) NW_001581981 u1 small nuclear ribonucleoprotein C-like LOC100022038 __SEG__ Chr6 {Monodelphis domestica} MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVRDYYQKWIEEQAQSLIDKTTTAFQQGRIPPNLFSAPPLGGPMIPPPHPSMMGPPPPGMMPMGPPPGMRMPMGSHMP
MMPGPPMMRPLPHPMMVPTRPAMPRPDR*
37 >lcl|XP_001374210.1|Plus1complement(32222482..32223924) NW_001581989 mRNA cap guanine-N7 methyltransferase-like LOC100022330 __SEG__ Chr7 {Monodelphis domestica} MENSAKTEDCEKIFEDEEADVVYKTELSVTVNENLTISKSESSDGKDTNSVQEVTPRKRKLEFQDDPDVETASCGEGTPSKTRKVDNEIILEERAAAGDEEGISRKRKLE
TDDVSKDDTSTCGGGTPSRKRKLEGEDIPVKRKPLEGHGATVAAYYNELQEVGLEKRSQSRIFYLRNFNNWIKSVLIGEFLEKVRQKKKRHITVLDLGCGKGGDLLKWKK
GKISKLVCTDIADVSIQQCQQRYTEMKNHCRDHEYIFSAEFVTADSSKELLTDKFRDPEICFDICSCQFVFHYSFETYEQADMMLRNACGKLSPGGYFIGTTPNSFELIK
RLEASETESFGNEIYTIRFQKKGEYPLFGCKYDFNLEGVVDVPEFLVYFPLLIEMAKKYKMKLVYKKTFLEFYEEKIKNIENKMLLKRMQGLEPYPANENAKLASGNVGD
YEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQP*
38 >lcl|XP_001374456.1|Plus1complement(3480827..3481768) NW_001587050 WD repeat-containing protein 82-like LOC100022679 __SEG__ ChrX {Monodelphis domestica} MKLTDGVLRSFRVAKVFRENSDKINSFDFSVSGETAVSSNSDDTITLYDCQEGKPKRTLYSKKYGVDIIKYTRAESTVIYSCNKIDDAIRYLSLPENKYIRYFHGHKKTV
VTLSMSPSDETFISGSIDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMIKLYDLRSFDKGPFATFRMEQDKTYEWTGLKFSKDGKHILLYTNGSCFHV
VDAFKGIVTHIFSGYNNHQALSLEAAFTPDSQFVMIGSEDGKIHIWNGENGEKVAVLDAKHTGPITCLQFNPNFMTFASACSNMSFWLPTIDD*
39 >lcl|XP_001375255.1|Plus13973630..3974415 NW_001581914 u11/U12 small nuclear ribonucleoprotein 35 kDa protein-like LOC100023821 __SEG__ Chr3 {Monodelphis domestica} MNEWMPIAKEYDPLKAGSIDGTDEEPHDRAIWRAMLARYVPNKGVSGDPHLTLFVGRLNLQTTEEKLKDVFSRYGDIRKLRLVRDVVTGFSKRYAFIEYKEERSLLKAYR
DANGLVIDQHEIFVDYELERILKGWIPRRLGGGFGGKKESGQLRFGGRDRPFRKPINLPVFKSDFYGEGQRERREWSRDRTWDWRARDHDRGREKRRQERETTRSWDENE
RERERDFRDERNRGRERKDRERRDRSKERDSKKQRDDDKHK*
40 >lcl|XP_001375930.2|Plus1complement(2151889..2154183) NW_001581846 ftsJ methyltransferase domain-containing protein 1-like LOC100024780 __SEG__ Chr1 {Monodelphis domestica} MNNWKKTSGDQAGGLEKFSPDVLADVSELFAKKFSYGKPPNNEWQLPDSNDVFTCDHTEFNSLLVLKNSMNEVKNLLSDKNLDDWHQHTSFTNKAGKIIPHVKKIVNAEL
CTQAWCKFHEVLCSFPLIPQEAFQNGELNSVHLCEAPGAFIASLNHYLRSHNIPCDWNWVANTLNPYHEANDNLMMIMDDRLIANTLPWWYFGPDNTGDIMTLKHLTGLQ
HFISNMSTVHLVTADGSFDCQGNPGEQEALVSPLHYCEVVTALMTLGNGGSFVLKMFTLFEHCSINLMYLLNCSFEEIHVFKPATSKAGNSEVYVVCLYYLGREAIHPLL
TKMMQHFGTEIINKALFPQHMIPESFLKRHEECCLFFHKYQLETISENIRLFECISEVEQTKLNNLRDCAVEYFMQKFQMKRLSRNNWLVKKSNIGCSMNSKWFGQRNRY
FKTYNERKMLEALSWEDKMTNGYFNHWAEEHAISNAGKNTILESVCANLEYHLWYILEGMKLPKVKCSPFCDGGILKTLNEAIEKSLGGALNLSSTLRQKPQHCYSCHVL
SEELIFSEMLSLAECYQDESAEGQSNKSKCLLVGLLPPDDKIYHSMEVSLLESADLMTFCCSLLHDGKPEYQQVFLDCFLRSLPRLQKGDVLILPVLSCFTRFMAGMVFV
LHSCFRFITFSCPTSSEPLSTCAVLLCVGYRDLPSPVLQYLQNLKELMSTLLNSDASHQVLQFVPMEVVLNGMLLEFLWDLNTAIAKRQLHLIIQGEQQQKSTL*
41 >lcl|XP_001376561.1|Plus1complement(68816045..68818132) NW_001581900 nucleoporin GLE1-like LOC100025713 __SEG__ Chr3 {Monodelphis domestica} MASEGRCWEALQAPRSSDRGPLSYHRDWPLRGQETLEERMSIPEWSTSSGCVADHILPPSQQNRLPSEDSSLSSAPDQVLSVPQTPARHAKVSSPVSLAAPSGTRRQEDE
LHQAKSVVLRPSRGTEVEGCIRLYEEVHRLKGTRGLRQRQEEHERKARLLSEMASEQLKRFDERTSRKQHKEYQDLQEGMEKSFRETQGQQEQLQEEHRHRAHMLHPKLR
EAEQQPSRHTGQGRLRKEEGQDRWRRLYALQEEALQLNQQLGASYRHNGLPRRDLSAFGGRGDQLCALISDIIRSASERGFPAPEDEATAERALQEMRHVLTGLQQEMAK
ATEEKRRPDEEECEDKQGQLEQRPRAEKETPDPGQCPGGKQREGLHVKAGDGTMQWYQQLQDAANQCVLAFDALTNSKDQEAKKIKMDLQKAATIPVSQISTIAGSQLKE
IFDKINNLLLGKAVPCGGRSVSVTNHQQGLDFVHYKLAEKFVKQGEEEVASHHEAAFPIAAVASGIWELHPRVGELILAHLHKKCPYSVPFYPAFQEGMASEEYQKLLGY
QVKDSKVEQQDSFLKRMSGMIRLYAAIIQLRWPYAERQGAHPHGLNHGWRWLAQLLNMEPLADVTATLLFDFLEVCGNALMKQYQLQFWKMMLLIKEEYFPRIEAITSSG
QMGSLIRLERFLENCLQQGEIPVPKGSLPPSFWLS*
42 >lcl|XP_001376576.1|Plus1complement(68821457..68823544) NW_001581900 nucleoporin GLE1-like LOC100025735 __SEG__ Chr3 {Monodelphis domestica} MASEGRCWEALQAPRSSDRGPLSYPSDWPLRGQETLEERMSIPEWSTSSGCVADHILPPSQQNRLPSEDSSLSSAPDQVLSVPQTPARHAKVSSPVSLAAPSGTRRQEDE
LHQAKSVVLRPSRGTEVEGCIRLYEEVHRLKGTRGLRQRQEEHERKARLLSEMASEQLKRFDERTSRKQHKEYQDLREGMEKSFRETQGQQEQLQEEHRHRAHMLHPKLR
EAEQQPSRHTGQGRLRKEEGQDRWRRLYALQEEALQLNQQLGASYRHNGLPRRDLSAFGGRGDQLCALISDIIRSASERGFPAPEDEATAERALQEMRHVLTGLQQEMAK
ATEEKRRPDEEECEDKQGQLEQRPRAEKETPDPGQCPGGKQREGLHVKAGDGTMQWYQQLQDAANQCVLAFDALTNSKDQEAKKIKMDLQKAATIPVSQISTIAGSQLKE
IFDKINNLLLGKAVPCGGRSVSVTNHQQGLDFVHYKLAEKFVKQGEEEVASHHEAAFPIAAVASGIWELHPRVGELILAHLHKKCPYSVPFYPAFQEGMASEEYQKLLGY
QVKDSKVEQQDSFLKRMSGMIRLYAAIIQLRWPYAERQGAHPHGLNHGWRWLAQLLNMEPLADVTATLLFDFLEVCGNALMKQYQLQFWKMMLLIKEEYFPRIEAITSSG
QMGSLIRLERFLENCLQQGEIPVPKGSLPPSFWLS*
43 >lcl|XP_001376595.1|Plus1complement(68826880..68828967) NW_001581900 nucleoporin GLE1-like LOC100025760 __SEG__ Chr3 {Monodelphis domestica} MASEGRCWEALQAPRSSDRGPLSYHRDWPLRGQETLEERMSIPEWSTSSGCVADHILPPSQQNRLPSEDSSLSSAPDQVLSVPQTPARHAKVSSPVSLAAPSGTRRQEDE
LHQAKSVVLRPSRGTEVEGCIRLYEEVHRLKGTRGLRQRQEEHERKARLLSDMASEQLKRFDERTSRKQHKEYQDLREGMEKSFRETQGQQEQLQEEHRHRAHMLHPKLR
EAEQQPSRHTGQGRLRKEEGQDRWRRLYALQEEALQLNQQLGASYRHNGLPRRDLSAFGGRGDQLCALISDIIRSTSERGFPAPEDEATAERALQEMRHVLTGLQQEMAK
ATEEKRRPDEEECEDKQGQLEQWPRAEKETPDPGQCPGGKQREGLHVKAGDGTMQWYQQLLDAANQCVLAFDALTNSKDQEAKKIIMDLQKAATIPVSQISTIAGSQLKE
IFDKINNLLLGKAVPCGGRSVSVTNHQQGLDFVHYKLAEKFVKQGEEEVASHHEAAFPIAAVASGIWELHPRVGELILAHLHKKCPYSVPFYPAFQEGMASEEYQKLLGY
QVKDSKVEQQDSFLKRMSGMIRLYAAIIQLRWPYAERQGAHPHGLNHGWRWLAQLLNMEPLADVTATLLFDFLEVCGNALMKQYQLQFWKMMLLIKEEYFPRIEAITSSG
QMGSLIRLERFLENCLQQGEIPVPKGSLPPSFWLS*
44 >lcl|XP_001376607.1|Plus1complement(68832303..68834390) NW_001581900 nucleoporin GLE1-like LOC100025780 __SEG__ Chr3 {Monodelphis domestica} MASEGRCWEALQAPRSSDRGPLSYHRDWPLRGQETLEERMSIPEWSTSSGCVADHILPPSQQNRLPSEDSSLSSAPDQVLSVPQTPARHAKVSSPVSLAAPSGTRRQEDE
LHQAKSVVLRPSRGTEVEGCIRLYEEVHRLKGTRGLRQRQEEHERKARLLSDMASEQLKRFDERTSRKQHKEYQDLREGMEKSFRETQGQQEQLQEEHRHRAHMLHPKLR
EAEQQPSRHTGQGRLRKEEGQDRWRRLYALQEEALQLNQQLGASYRHNGLPRRDLSAFGGRGDQLCALISDIIRSASERGFPAPEDEATAERALQEMRHVLTGLQQEMAK
ATEEKRRPDEEECEDKQGQLEQRPRAEKETPDPGQCPGGKQREGLHVKAGDGTMQWYQQLQDAANQCVLAFDALTNSKDQEAKKIKMDLQKAATIPVSQISTIAGSQLKE
IFDKINNLLLGKAVPCGGRSVSVTNHQQGLDFVHYKLAEKFVKQGEEEVASHHEAAFPIAAVASGIWELHPRVGELILAHLHKKCPYSVPFYPAFQEGMASEEYQKLLGY
QVKDSKVEQQDSFLKRMSGMIRLYAAIIQLRWPYAERQGAHPHGLNHGWRWLAQLLNMEPLADVTATLLFDFLEVCGNALMKQYQLQFWKMMLLIKEEYFPRIEAITSSG
QMGSLIRLERFLENCLQQGEIPVPKGSLPPSFWLS*
45 >lcl|XP_001377139.1|Plus1complement(5888190..5888606) NW_001587046 u1 small nuclear ribonucleoprotein C-like LOC100026583 __SEG__ ChrX {Monodelphis domestica} MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVRDYYQKWMEEQAQSLIDKTTTAFQQGRIPPNLFSAPPLGGPMIPPPHPSMMGPPPPGMMPVGPPPGMRMPMGGHMP
MMPGPPMMRPLPHPMMVPTRPAMPRPDR*
46 >lcl|XP_001377523.1|Plus1complement(54833205..54834044) NW_001582021 ribonuclease P protein subunit p38-like LOC100027139 __SEG__ Chr8 {Monodelphis domestica} MAAASGKGSIRKAKSFTVKTVLNNPYAVNWTTLDRDDMHFILQTLEERFKHVGLQKIENPKKKKRPISKRQTKEKDSIDNDEVPKKKETEVSQKVPGWTPIHVRKQLAIG
INEVTRALEKNELLLVLVCKSVKPAMMTSHLIQLSVSRAIPACQVPRLSESIAPVIGLKCVLALGFKKNTEAFVEELKAIIPRVPSLHVPWLHDKTKDSLEDTDIETLET
QDANVLETSFEELTKNKRKLVECQQDTSAVTLQPLKIKKLIPNPNKIKKPSKNKKTTLK*
47 >lcl|XP_001378009.1|Plus164691089..64691505 NW_001581989 u1 small nuclear ribonucleoprotein C-like LOC100027820 __SEG__ Chr7 {Monodelphis domestica} MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVRDYYQKWMEEQAQSLIDKTTTAFQQGRIPPNLFSAPPLGGPMIPPPHPSMMGPPPPGMMPVGPPPGMRMPMGGHMP
MMPGPPMMRPLPHPMMVPTRPAMPRPDR*
48 >lcl|XP_001378670.2|Plus161776183..61777187 NW_001582021 pre-mRNA cleavage complex 2 protein Pcf11-like LOC100028702 __SEG__ Chr8 {Monodelphis domestica} MGPNFNESHGPGAQGFANSLNRASGHYFDEKNLWGPWLGNFGNLPTPIAVGNIQSSQQVLSGVTQPVAFGQAQQFLPVHPQNPGTFVQNPAGTLPQAYPDNHLSQVDVNE
LFSNLLKAGILKLSQPHSATTQVNEGTAQPPPKEEDQGVPDLTNFKVEELKQRYDSVIDRLYTGIQCSSCGMRFTTSQNNVYADHLDWHYRQNRTQKDLSRKVTHRRWYY
SLTDWIEFEEIADLEECAKSQFCQKGHEEVVLKTQEAAKEKEFWSVPAGPAGVVESCEICQEQFEQYWDEEEEEWHLENAIQVGGYIYHPSCYEHQNTSSFDCTPAPSDH
QGRL*
49 >lcl|XP_001378776.1|Plus161864796..61865800 NW_001582021 pre-mRNA cleavage complex 2 protein Pcf11-like LOC100028861 __SEG__ Chr8 {Monodelphis domestica} MGPNFNESYGPGAQGFANSLNRASGHYFDEKNLRGPWFGNFGNLPTPIAVGNIQSSQQVLSGVTQPVAFGQAQQFLPVHPQNPGTFVQNPAGTLPQAYPDNHLSQVDVNE
LFSNLLKAGILKLSQPDSATTQVNEGTAQPPPKEEDQGVPDLTNFKVEELKQRYDSVIDRLYTGIQCSSCGMRFTTSQNNVYADHLDWHYRQNRTQKDPSRKVTHRRWYY
SLTDWIEFEEIADLEECAKSQFCQKGHEEVVLKTQEAAKDKEFWSVPAGPAGVVESCEICQEQFEQYWDEEEEEWHLENAIQVGGYIYHPSCYEHQNTSSFDCTPAPSDH
QGRL*
50 >lcl|XP_001379497.1|Plus1complement(60190..62199) NW_001587038 polyadenylate-binding protein 1 PABPC1 __SEG__ ChrX {Monodelphis domestica} MAAYIPPAEDTGLGGGGLFGLDLIPGTIGLSGGSHGHSTPNSPTASLYVGDLHHDVTESMLYEKFSPAGPILSIRVCRDSVTQHSLGYAYVNFQHRAHAEWVLATMNLDV
IKGNPIRIMWSQRDPGQRKRGVGNVFVKNLEKSIDNKALYDTFSTFGRILSCKVISDENGSKGYGFVHFETQESAGKAIEKMNGMLLNNLKVFVGRFKSRRERESELGVK
AKDYTNIYIKNFGENMDDQRLTEIFAKYGPTLSVKVMTDDCGRSKGFGFVSFQSHEDAQAAVDDMNGKQLNGKQIYVGRAQKKRERQTELKRHFEQIKQNQHIRYQGVNL
YIKNLDDTINDEHLRKEFSPFGTITSAKVMMENGRSKGFGFVCFSSSKDAAKASREMNGKLVASKPLYVSLAQRKEERRMHLKNQYMYRLAHLRSISNPVFNPYQLANSS
PYFMTPSLPSQSQAALYNASQLAQLRSSPRWISKSIRPPSFHTLTKAICPNIPRATFSPLRSTSEIPRMGATSRVANSPAQMLGPLPGTGTFLPTVPNVPHLKYDAGVDY
PEQPFSKSPYISTLARQPAGHISGQESLMPSMLASALPPEQKRILGERLFPIIQGISPTLAGKITGMLLETDNSEILHLLESPESLHCKVKEAAAVLQTHQAKEVTQKEV
NGATGGAPT*
51 >lcl|XP_001381348.1|Plus1complement(19853242..19854087) NW_001581866 CCR4-NOT transcription complex subunit 7-like LOC100032306 __SEG__ Chr2 {Monodelphis domestica} MPTTVDHSQEICEVWAWNLDEEMKKIHQVIGQYNYVAMDTEFPGIVARPTGQFQSNADYQYQLLKCNVNLLKIIQLGLTFMNEQGEHPPGTSTWQFNFKFNLAEDMYAQN
SIKLLTKAGIQFKKLEEEGIEPEYFAELLMTSGVVLCEGVKWLSFHSSYDFGYLIKILTNSNLPEEALDFFEILHLFFLVIYDVKCLMKSCKNLRGGLQEVAEQLGLERI
GPQHQAGSDSLLTGMVFFKMRKMFFEDHIDDAKYGGQLYGLHLGSSCIQDDACEEEASKQP*
52 >lcl|XP_001381359.1|Plus119919519..19921939 NW_001581866 cell division cycle 5-like protein-like LOC100032322 __SEG__ Chr2 {Monodelphis domestica} MPRVMIKGGLWRNTEDEVLKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWTREEEEKLLHLAKLMPTQWRTLAPIIGRTAAQCLQHYELLLDKAAQR
DGEEETEDDPRKLKPGEIDPNPESKPAKPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIDLQKRKRKRGIDYNAEIPLEKKPA
PGFYNTLEESYPTLDADFSQLRQEDLDGELRSKKESRARKRDQQYWKSKKEADLPSAILQPPGISGFTKKRSKLVLPAPQISEAELQRVVKVVQASEIARHTAEESGIVN
SVSSTLLSEYHVTNASIALRTPKVPEAQDGILKEAQNLLALTNIDTPLKGGLNTPLHESDFSGVTPQQQIIQTPNTVLFTPFRTPRGAEGSTLQVGMAPKPLVGPTPQRT
SLRDKLNINPEESLADYNDPSYGKQTERESQERLRLGFLGLPTPKNDFEIVLPENVKELEDLEIEETFAEDAADADARRQAIQDAEHAKEIKQMHTAVQKGLPRPSEVNE
AILRPLHGGPPLADLEKSEELIKKEKIIMLHYDLLHHPYGEHAGNKKGKPRGFGSNSTQHITYLELNPYENFSKDELDKAQDLLTQEMEVIKQGMCHGELSNEVYNQVWE
ECYSQILYLPRQRRYTRANLASKKDRIESLEKRLEINRGLMTTEAKRAAKMEKKMKILLGGYQSRGMGLRKDLNALWDQIEHAYLELRTLELLKKQEDSAILRRLECLKE
DVQRQQEREKVLQQRYAHLLLEKDFEAQMLQTSLFS*
53 >lcl|XP_001381370.1|Plus1complement(20050117..20052528) NW_001581866 cell division cycle 5-like protein-like LOC100032336 __SEG__ Chr2 {Monodelphis domestica} MPRIMIKGGLWRNTEDEVLKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWTREEEEKLLHLAKLMPTQWRTLAPIIGRTAAQCLQHYELLLDKAAQR
DGEEETEDDPRKLKPGEIDPNPESKPAKPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIDLQKRKRKRGIDYNAEIPLEKKPA
PGFYNTLEESYPTLDADFSQLRQEDLDGELRSKKESRARKKDQQYWKSKKEADLPSAILQPPGISGFTKKRSKLVLPAPQISEAELQRVVKVVQASEIARHTAEESGIVN
SVSSTLLSEYHVTNASIALRTPKVPEAQDGILKEAQNLLALTNVDTPLKGGLNTPLHESDFSGVTPQQQIIQTPNTVLFTPFRTPRGAEGSTLQVGMAPKPLVGPTPQRT
SLRDKLNINPEESLADYNDPSYGKQMERESQERLRLGFLGLPTPKNDFEIVLPENVKELEDLEIEETFAEDAADADARRQAIQDAEHAKEIKQMHTAVQKGLPRPSEVNE
AILRPLHGGPPLADLEKSEELIKKEKIIMLHYDLLHHPYGEHAGNKKGKPRGFGSNSTQHITYLELNPYENFSKDELDKAQDLLTQEMEVIKQGMCHGELSNEVYNQVWE
ECYSQILYLPRQHRYTRANLASKKDRIESLEKRIEINRGLMTTEAKRAAKMEKKMKILLGGYQSRGMGLRKDLNALWDQIEHAYLELRTLELLKKQEDSAILRRLECLKE
DVQRQQEREKVLQQRYAHLLLEKDFEAQMLQTL*
54 >lcl|XP_003341185.1|Plus1complement(5279847..5280218) NW_001581954 u7 snRNA-associated Sm-like protein LSm10-like LOC100031566 __SEG__ Chr4 {Monodelphis domestica} MEVSHSVKERTIAENSLVILLQGLRGLVTTVDLRDETVARGRVDNVDAFMNIRLAEVTYTDRQGQQVQLDDLFVTGRNVRYVHIPDDVDITATIEQQLQAIHRVRNFGSE
GKGRREFPARKYK*
55 >lcl|XP_003341673.1|Plus1complement(9202693..9203007) NW_001581978 LYR motif-containing protein 7-like LOC100619857 __SEG__ Chr6 {Monodelphis domestica} MVDSTKVLQLFKTLHRTRQQVFKNDVRALEASRKKINEEFKSHKNETSPEKIEELIKIGSDVELILRKSVIQGIHTDHNTLKLVPRKELLTESKPSCNVPTQKP*
56 >lcl|XP_003341979.1|Plus15285152..>5287113 NW_001582006 YTH domain-containing protein 1-like LOC100020111 __SEG__ Chr8 {Monodelphis domestica} MAANNQEEKDGDLNVLDYILTEEHEQDNNLCNPEMEQDQNVENDSKRKCDQIETTQSKSQKSAGHSRQLTLKPLRITISDNKRIIRTNTNENCQRSERAEGKSHLSGELY
KSQPEKTSVRKRDLQRRTESSTPDDSQRIRQDVDRWHSRSRLSSKEVGSEEYDYETGSSDSSKEHENCRKNEKEGMEEEEEWDDETKDETNRGEKDKQDKRNQKERNNYD
TRSEANDSYSETVSFTEGSVRSGPSTDGSDEKKEGRKRARGIASIVFHRSTSFVSASERKHNKSASSFHADQTRRLKYILRDARFFLIKSNNYENISLAKARGIWSTLPT
NERKLNAAFRSARNVILIFSVRESRKFDGFARLSSESHHGGSPIHWVLPESMNPKMLGGVFKIDWICRHELPFTKSAHLTNSLNEYKPVKIGCDGQEIDFECGTQLCLLF
CPDESVDLYQVIHKMHHKRRMHSQFHSRGRPSHQESGQYVRRHQSEDYDIHNSRKKPRIDYTPGFHQRPGHIKDPPYQEAYRRFSGVPRDVFLNRSNNDYLGTFYDRRSP
SPRQGMSPYLEIEQSSYHPYYQDHAPPFQDSYSGRQPIPREARHRDKQVCDYMWGHDFLHKTQAIVSGRRSRSCKRDGDRKCEYSRYIRRNREKDQWKERRREE
57 >lcl|XP_003342141.1|Plus1complement(61676510..61676740) NW_001582021 small nuclear ribonucleoprotein G-like LOC100618424 __SEG__ Chr8 {Monodelphis domestica} MSKAYLPELKKFMDKKLSLKLNGGRPIQGILRGSDLFMNLVADECVEMAPGGQQNNIGMVVIQGNSIIMLEALEQV*
58 >lcl|XP_003342337.1|Plus12377047..2379896 NW_001587048 probable ATP-dependent RNA helicase DDX43-like LOC100617106 __SEG__ ChrX {Monodelphis domestica} METDRSSAAHYDVSTSGSQSSENPGSIPSRATTGETDKSYAAHHLVPASEPWTVEKPKPPLPQSPTAETERRYAAHLLVPTSDPWSLAEKPKSLPSQPSAVEPDSSYGAH
SSLLTSEPWSSVENLIFPSQASTTETDSSYLDHLAMPPYELWSPVDKLMPLSFHLSPVEKFNSHTTTYNSNLTSSGFDVPSVVSKTPLEKSLPLSPYQLESYNNFATCTI
SPPSSSFAMSSSEPQASEKNLISPPSRSSTRSKSSSHTIHNISPASPGVILPASESQPSRKNLISPPFHLSTRRKSTDYTTRTISPACARQSSSKHLTPPLSPFCSTETA
SSYATGNIGPSLPGPAHNIGTKGQGRGNLRGLSGPLAAQETQAQSSCKKDSPLCFMIKTGVIGASTSQRGNKVKKLPEFPGSKMRNPRGESESEARAYGKQQSQKPAKSA
MEETVKKAERYSKEGAKRSGTLKTSTEKATERKVPVIDWDAIRQSHLQYIKNKWGSLPPVKKDFYVESARTKSMLQSEADRWRKENNNVTCDDLKTNEKRSIPHPVCQFE
DAFHQYPEVMENIRKVGFSKPTPIQSQAWPIILKGIDLISIAQTGTGKTLAYLMPGFIHLDHQPVAREERRGPGMLVLTPTRELAIQVDNECKKYTYKGIKSMCIYGGDK
SGPTEHIPRGIDIIIATPGRLSDLQMNDLVNLNSITYVVLDEADKMLDMGFEPQIMKILSDIRPDRQTVMTSATWPDIVRHLSQKYLKDPMIVYVGTLDLTTVNTIKQKI
IVTTEEEKRVLLRSFIDSLMPEHKVIIFVSRKLIADDISSDLSIKGIPVQSLHGSREQDDRDQALEEFKKGIVKILIATDLASRGIDVLDVTHVFNFDFPQNIEEYIHRI
GRTGRAGQSGSSITLLTKGDWSVAGELINILQRANQEVPRELASMARQYKQYKHRKNEEKKLRYYSRPR*