SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab A    

ID / Description / Sequence
1 >lcl|XP_001490425.1|Plus1complement(29041247..29042317) NW_001867379 poly(rC)-binding protein 1 PCBP1 __SEG__ Chr15 {Equus caballus} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
2 >lcl|XP_001491140.1|Plus16818140..6818892 NW_001867393 neuroendocrine secretory protein 55-like LOC100050675 __SEG__ Chr22 {Equus caballus} MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHRSGAQAFPEPPESDQEHEEADLELSLPECLEYEEEFDYESE
TETESEIESETDFETEPETAPATEPETEPEDERGPVVPKRPTFGERGSLTQRLQALRLRSPDASPSRAQPSTQEPQSPREGEEPEPEDKDPRDPEESEEPKEKEKKEKQQ
QRRCKPKKPTRRDPSPESPSKRGPIPIRRH*
3 >lcl|XP_001491392.2|Plus1722359..723534 NW_001877045 heterogeneous nuclear ribonucleoprotein D-like LOC100058339 __SEG__ ChrX {Equus caballus} MVKPGSLYCPFQTSAQSRGATSPRFCFVISPRQFPYCSSLSVEPQATLSTSSPRRQPAARLSSVDVISFAMSKLNQMDQYLEGFRIEATRNQQDGSKMFIGGLSGNVSKQ
GLLDYLSQFGEVVDFIIKIHPGTGLSRGFGFVLFKDSATVEKVLQVKEHKLDGKTIQLRRAKAVVSRFPPKKVFVGGLNPRLSEEKIRQYFGTFGVIQDIKLPVNSKTNE
RRAFCFITYADEKAVRKLLETRYHRIGSRRCEVKIAFPKEYKRLRQLGGRDAPFARLSSSRDGRGVRADPSACGANQNVGGAFGGGQSPSTVLVPAPFLACNQGFNFPDQ
IYGNFQHAYTNQPIFNSYGGEYLLGYNYGTHAFGTTFTNYTVQINEAAPFGPGYQGIYQPF*
4 >lcl|XP_001492319.2|Plus117345723..17347597 NW_001877040 probable ATP-dependent RNA helicase DDX53 DDX53 __SEG__ ChrX {Equus caballus} MAWAPEWRRAEPRDGRASRDGRGGTGGSGLSRYWEPRAFGSREPPLCFRIKNSMVGVVIGRGGSKIKDIQSMTSTKIQIVKGDSEAEVKIFGSEAMKGKAKALIQTLVRK
QEGRYSSVASVDNAASQSSAGRDLRTRPVVRQVRPLIDWDHVKAEGAAWAKRKWADLPPIKKNFYVESTATSSLSQVQVDAWRQENFNITCEDLKDGEKRPIPNPTCKFE
DAFEHYPEVLKSIKKAGFQRPTPIQSQAWPIVLQGMDLIGVAQTGTGKTLSYLIPGFIHLDSQPISREERNGPGMLVLTPTRELALQVEAECSKYSYKGLKSVCVYGGGN
RKEQIQHITKGVDIIIATPGRLNDLQMNKCVNLRSITYLVLDEADKMLDLGFEGQITKILLDVRPDRQTVMTSATWPHTIRQLARSYLKEPMIVYVGTLDLVAVHTVKQD
IIVTTEEEKRTLIQEFLRNLAPEDKAIIFVSRKLVADDLSSDLSIQGVPVQSLHGNREQFDREQALDDFRSGRVKILIATDLAARGLDVRDVTHVYNYDSPKNLEEYVHR
VGRTGRAGKTGVSVTLMTQADWKIATELIKILERANQSVPEDLLKMAEQCKLQKGKKDSGNGARNPQGKAKQFY*
5 >lcl|XP_001493828.1|Plus15477817..5479166 NW_001877045 heterogeneous nuclear ribonucleoprotein H2 HNRNPH2 __SEG__ ChrX {Equus caballus} MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTAND
GFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYN
SIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGE
ADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQEN
SSDYQSNLA*
6 >lcl|XP_001494792.1|Plus1complement(19100389..19101594) NW_001867389 splicing factor 45-like LOC100052363 __SEG__ Chr20 {Equus caballus} MSLYDDLGVETSDSKTEGWSKNFTLLQSQLQVKRAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPRFPNDYEK
VVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRTDPDSDEDEDYERERRKRSMGGAAITPPTSLVEKDKELPRDFPHEEDSRPRSQSSKAGIPPPVYEEQDKP
RSPTGPGNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSMALSVEKTSKRGGKIIVGDATEKDAAKKSDSNPLTEILKCPTKVVLLRNMVGAGEVDEDLEVETKEEC
EKYGKVGKCVIFEILGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV*
7 >lcl|XP_001498122.1|Plus110313411..10314151 NW_001867429 u11/U12 small nuclear ribonucleoprotein 35 kDa protein-like LOC100059055 __SEG__ Chr8 {Equus caballus} MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYAPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERSLIKAYR
DADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNEQYREGKREKRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVW
PESDWERERDFRDDRVKGREKRERRE*
8 >lcl|XP_001498370.2|Plus122530446..22532752 NW_001867410 ftsJ methyltransferase domain-containing protein 1-like LOC100068485 __SEG__ Chr3 {Equus caballus} MSKCRKPPLGSSPETFSPDVLADVAELFAKKFSYGKSLNNEWQLPDASEIFTCDHKEFNAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCT
QAWCKFHEILWSFPLIPQEAFQNGKLNTLHLCEAPGAFIASLNHYLKSHRLPCDWSWVANTLNPYHEANDNLMMIMDDRLIANTLRQWYFGPDNTGDIMTLQYLTGLQNF
VSNMATIHLITADGSFDCQGNPGEQEALVSSLHYCEVVTALMTLGNGGSFVLKMFTLFEHCSINLMYLLNCSFDQVHVFKPATSKAGNSEVYVVCLHYKGREAVHPLLSE
MVLNFGPEMTRKALFSHHVIPESFLKRHEECCVFFHKYQLETISENIRLFECMGKGEEAKLNNLRDCAVQYFMQKFQLKPLARNKWLVKKSNIGCSTNTKWFGQRNKYFK
TYNERKMLETLSWKDKVAKGYFNSWAEEHAAYHPGQCSLLEGTASDCECLLWHILEGKKLPKVKCSPFCDGEILKTLNEAIEKSLGGALNLDSKFRAKQQYYCSCHIFSE
ELIFSELFSLTKCLQDDQVVEPSNRVKCLLVGFPTRSDFQMHIPLEVRLLESAELMTFSCSLLHDGDPTYQQLFLDCLLHSLQQLHTGDVLILPVLSCFTRFMAGLIFVL
HSCFRFITFSCPTSSEPLKTCAVLLCVGYQDLPNPVFQYLQNVSDLLSALLNADAPEQVLEFVPMEVLLKGALLDFLWDLNAAIAKRHLHLIIQREREEIISSLQLGN*
9 >lcl|XP_001498383.1|Plus1complement(19988097..19988942) NW_001867401 ribonuclease P protein subunit p38-like LOC100056256 __SEG__ Chr29 {Equus caballus} MAAAPRAPARGSVRKTRPLTVKTSLNNPYTLCWSPLEREDMLFILQTLEDRFRSVGLQKIEDKKRKKKQPFLKKQSRDKCSIDVDINEETEKQPEGEHQVSGWTPVHVRK
QLAIGVNEVTRALERSELLLVLVCKSVQPAIITSHLIQLSVSRTVPACQVPRLSERVAPVIGLKCVLALGFKKNTTAFVDEVEAIIPRVPRLNVAWLQDSLEASRDNLEP
ESLESQDKELLETSFEDVSKCKRKPVEGQQAVVLQPLKIKKLIPNPNKIRKPPKSKKTTSK*
10 >lcl|XP_001499097.1|Plus121069096..21069467 NW_001867402 u7 snRNA-associated Sm-like protein LSm10-like LOC100069271 __SEG__ Chr2 {Equus caballus} MAVSHSVKERTISENSLIILLQGLQGQVTTVDLRDESVARGRIDNVDAFMNIRLANVTYTDRWGHQVELDDLFVTGRNVRYVHIPDDVNITATIEQQLQVIHRVRNFGGK
GQGRREFPSKKYK*
11 >lcl|XP_001499556.2|Plus1complement(24109151..24111661) NW_001867391 tuftelin-interacting protein 11-like LOC100053450 __SEG__ Chr21 {Equus caballus} MSLPHFYRDGEGHMDDDEDERENFEITDWDLQNEFNPNRQRHWRTKEEATNGVWTERASDGERPSFGGKRARDCSAPVSFISAGLKKRAAEEAELEDSDDEEEPVKQDDF
PKDFGPKKLKTGGNFTPSQKGFAGGTKSFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIIKPIEAKQRKGRGAVGAYGSERTPQSLQDFPVVHSKEEAEEFQKE
LSQWRQGPSGSKKKPKYFYKTVEELKAKGRVSKQLTAPEKELSQVKVIDMTGREQKVYFSYSQISHKHNVPGDGLLLQSPQPPQPGKEAKAPGFALPELEHNLQLLIDLT
EQEIIQNDRQLQYERDMVVNLSHELEKMSEVLDHEERLISKLSKVLEMVEECERCMQPNCSDPLTLDGCTHIFETLRDKYYEDYWMSHRVDLTVAIVYPLMKEYFKEWDP
LKDCTYGTEIISKWKSLLENDQLLSHGEQDLLADAFHRLIWEVWMPLVRNIVTQWQPRNCDPMVDFLDSWVHIIPVWILDTILDQLIFPKLQKEVENWNPLTDTIPIHSW
IHPWLPLMQARLERLYSSIRSKLSRALQKWHPSDSSAKLILQPWKEVFTPGSWEAFMVKNIVPKLEMCLGELVINPHQQHMDAFYWVITWEGMISVSSLVGLLEKHFFPK
WLQVLCSWLSNSPNYEAITKWYLGWKSVFSDQVLAHLSVNDKFNEALDIMNRAVSSNVGAYMQPGARENIAYLTHVERRKDFQYEAMQERREAENMAQRGIGMAAGSMPM
NFKDLIETKAEEHNIVFMPIIGKRHEGKQLYTFGPIVMYIDRGVVFIQGKKTWVPTSLQSLIDMAK*
12 >lcl|XP_001500582.1|Plus115561622..15561852 NW_001877044 small nuclear ribonucleoprotein G-like LOC100071683 __SEG__ ChrX {Equus caballus} MNKAQPPELKKFMDKKLSLKLHGGRHVQGILWGFDPFVNLVIDECVEMTTSGQQNNIGMVVIQRNGIIMLEALERV*
13 >lcl|XP_001501077.1|Plus1complement(48705600..48706562) NW_001867420 putative heterogeneous nuclear ribonucleoprotein A1-like 3-like isoform 1 LOC100054206 __SEG__ Chr5 {Equus caballus} MSKSESPKEPEQLRKLFIRGLSFETTDESLRSHSEQRRTLTDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVLREDSQRLGAHLTVKKLFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFLTFDDHDSVDKSVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGQSGSGNFGGGRGGGFGGNDNFGCGG
NSVVELASVAAVAGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRCSGPYGGGGQYFARPRNQGGYGGSSSSSSYGSGRRF*
14 >lcl|XP_001501893.2|Plus117000739..17001887 NW_001877044 polyadenylate-binding protein 5 PABPC5 __SEG__ ChrX {Equus caballus} MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFI
KNLDKSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNFGDDMDDEKLKEIFS
EYGSTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRAPGVPIYIKNLDETIDDEKLKEEFSSFGSISR
AKVMVEVGQGKGFGVVCFSSFEEATKAVDEMNGRIMGSKPLHVTLGQARRRW*
15 >lcl|XP_001914759.1|Plus164004..64606 NW_001877044 polyadenylate-binding protein 1-like 2-like LOC100146775 __SEG__ ChrX {Equus caballus} MASLYVGDLHPEVTEAMLYEKFRPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIF
SAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDAMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATFR*
16 >lcl|XP_001917732.1|Plus1complement(42306180..42308039) NW_001867386 cleavage stimulation factor subunit 2 tau variant-like LOC100062520 __SEG__ Chr1 {Equus caballus} MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPI
IDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQPVSGPGPGICPGPN
VLLNQQNPPAPQPQHLARRPVKDIPPLMQTPIQGGIPAPGPIPTGVPGPGPGSLTPGGAMQPQVGMPGVGPVPLERGQVQMSDPRAPMPRGPMTAGGLPPRGLLGDAPND
PRGGTLLSVTGEVEPRGYLGPPHQGPPMHHASGHDSRGPSSHEMRGGPLADPRMLIGEPRGPMMDQRGLPLDGRGSRDSRGMETRAMETEVLETRVMERRGMETCAMEAR
GMEARGMDARGMEIRGPGPSSRGPMTGGIQGPGPINMGAGGPQGPRQVPSISGVGNPGAGMQGAGIQGAGMQGAGMQGSGMQGAGMQGAGMQGAGIQGVGMQGAGIQGTG
MQGAGKQGGGQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS*
17 >lcl|XP_003363635.1|Plus1complement(25858048..25858542) NW_001867387 serine/arginine-rich splicing factor 3-like LOC100053336 __SEG__ Chr1 {Equus caballus} MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPP
PRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK*
18 >lcl|XP_003363688.1|Plus13790083..3791327 NW_001867387 heterogeneous nuclear ribonucleoprotein F-like LOC100050002 __SEG__ Chr1 {Equus caballus} MMLGPEGGEGFVVKLRGLPWSCSIEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFIELESEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADTAND
GFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLERMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDGEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQMMQGMGVSAQSTYSGLESQSVSGCYGAGYSGQNSMGGYD*
19 >lcl|XP_003365797.1|Plus117468943..17470817 NW_001877040 probable ATP-dependent RNA helicase DDX53-like LOC100059831 __SEG__ ChrX {Equus caballus} MAWAPEWRRAEPRDGRASRDGRGGTGGSGLSRYWELRAFGSREPPLCFRIKNSMVGVVIGRGGSKIKDIQSMTSTKIQIVKGDSEAEVKIFGSEAMKGKAKALIQTLVRK
QEGRYSSVASVDNAASQSSAGRDLRTRPVVRQVRPLIDWDHVKAEGAAWAKRKWADLPPIKKNFYVESTATSSLSQVQVDAWRQENFNITCEDLKDGEKRPIPNPTCKFE
DAFEHYPEVLKSIKKAGFQRPTPIQSQAWPIVLQGMDLIGVAQTGTGKTLSYLIPGFIHLDSQPISREERNGPGMLVLTPTRELALQVEAECSKYSYKGLKSVCVYGGGN
RKEQIQHITKGVDIIIATPGRLNDLQMNKCVNLRSITYLVLDEADKMLDLGFEGQITKILLDVRPDRQTVMTSATWPHTIRQLARSYLKEPMIVYVGTLDLVAVHTVKQD
IIVTTEEEKRTLIQEFLRNLSPEDKAIIFVSRKLVADDLSSDLSIQGVPVQSLHGSREQFDREQALDDFRSGRVKILIATDLAARGLDVRDVTHVYNYDSPKNLEEYVHR
VGRTGRAGKTGVSVTLMTQADWKIATELIKILERANQSVPEDLLKMAEQCKLQKGKKDSGNGARNPQGKAKQFY*