SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam A    

ID / Description / Sequence
1 >lcl|XP_003431523.1|Plus1complement(52506640..52506870) NW_876251 small nuclear ribonucleoprotein G-like LOC100685194 __SEG__ Chr10 {Canis lupus familiaris} MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
2 >lcl|XP_003431580.1|Plus1complement(33584643..33584951) NW_876251 U6 snRNA-associated Sm-like protein LSm3-like LOC100682688 __SEG__ Chr10 {Canis lupus familiaris} MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDLELRGRLHAYDQHLNMILGDVEETVSTIEIDEETYEEIYKSTKRNIPMLFVWGDGVVLVAPPLRVG*
3 >lcl|XP_003431805.1|Plus1complement(33657091..33657972) NW_876254 heterogeneous nuclear ribonucleoprotein C-like 1 HNRNPCL1 __SEG__ Chr12 {Canis lupus familiaris} MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGRLLDINLAAEPKVNRGKAGVKRSAAEMYGSSFD
LDYDLQRDHYDRMYSYPARGPPPPPIARAVVPSKRPRVSGNTSRRGKSGFNSTSGQRGSSSKAGKLKGDDLQTIKKELTQIKQKVDSLLESLERIEKEQSKQGEMKNDKS
EEEQSSSSLKKDVTNVKRESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS*
4 >lcl|XP_003431873.1|Plus17174236..7174991 NW_876257 RNA-binding protein Musashi homolog 2-like LOC100682572 __SEG__ Chr13 {Canis lupus familiaris} MADLTSVLTSVMFSPSSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFV
GGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVA
TYGRGYPGFAPSYGYQFPDYLPISQDIIFIN*
5 >lcl|XP_003431934.1|Plus1complement(11431284..11431592) NW_876258 U6 snRNA-associated Sm-like protein LSm3-like LOC609218 __SEG__ Chr14 {Canis lupus familiaris} MADDVDQQQTTNTVEEPLDLIRLSPDERIYVKMRNDRELQGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG*
6 >lcl|XP_003432319.1|Plus1complement(2176696..2177145) NW_876264 pre-mRNA-splicing regulator WTAP-like LOC100682676 __SEG__ Chr17 {Canis lupus familiaris} MTNEEPLPKKVRLSETNFKVMARDEFILRWKQYEAYVQALGGKYTDLNSNDVTGLRESEEKLKQQESARRENILVVRLATQGAEMLECTTQIQYPQQVQQPSVAQLRSTM
VDPAINLFFLKMKGELEQTKDKLEQAQNELGAWKFMPDR*
7 >lcl|XP_003432333.1|Plus1complement(10384881..10385105) NW_876265 small nuclear ribonucleoprotein G-like LOC100687557 __SEG__ Chr18 {Canis lupus familiaris} MSKAHPPKLKKFMDKKLSLKLNGGRHVQGILQGFDPFMNLVIDEFVEMATSGQQNNIGMAVIRGNSIIMLEDLE*
8 >lcl|XP_003432385.1|Plus1complement(28309308..28310012) NW_876266 nucleolar protein of 40 kDa-like LOC100687648 __SEG__ Chr18 {Canis lupus familiaris} MNSGRPETMEHLPALYIIFQGEIAMVTDYGAFIKIPGCQKQGLVHRTHMSSCRMDKPSEIVDDGGKVWVKLIGREMKNDRIKVSISMKVINQGTGKDLDPNNVIIEQEER
RLQSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDSTRNSSRKRKKEKKKKTHGDRKLSESDSSDSESDTSKRARHTS
KDSKAAKKKKQHRE*
9 >lcl|XP_003432400.1|Plus1complement(30432513..30432803) NW_876266 N-alpha-acetyltransferase 38, NatC auxiliary subunit-like LOC100685900 __SEG__ Chr18 {Canis lupus familiaris} MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH*
10 >lcl|XP_003432672.1|Plus123594335..23594613 NW_876270 small nuclear ribonucleoprotein E-like LOC100684753 __SEG__ Chr1 {Canis lupus familiaris} MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQINMRIEGCIIGFDEYMSLVLDDAKEIHSKTKSRKQLGRIMLKGDNITLLQSVSN*
11 >lcl|XP_003432973.1|Plus137760985..37761293 NW_876273 U6 snRNA-associated Sm-like protein LSm3-like LOC476868 __SEG__ Chr21 {Canis lupus familiaris} MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEEAYEEIYKSTKWNIPMLFVRGDGVVLVAPPLRVG*
12 >lcl|XP_003433093.1|Plus1complement(50381826..50382887) NW_876274 heterogeneous nuclear ribonucleoprotein D-like LOC608400 __SEG__ Chr22 {Canis lupus familiaris} MVEPSGAGLLNKILGNLENRNAFKVLKSSAAAVLNPAPYNAPPPTPAASSATMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDC
TIETVPVTGRPRGFGFVLFKDAASVDKVLELKEHKLDGKLINPKRAKALKGKEPPRKIFVGGLSPDTCEEQIKEYFGAFGEIEYIELPMDTKTNERRGFCFITYTDEEPV
KELLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYVDYS
GQQSTYGKASRGGGSYQNNYQPY*
13 >lcl|XP_003433348.1|Plus114190060..14190368 NW_876278 U6 snRNA-associated Sm-like protein LSm3-like LOC607742 __SEG__ Chr25 {Canis lupus familiaris} MADDVGEQQTTNTIEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEINKSTKRNIPMLFVWGDGVVLVAPPLRVG*
14 >lcl|XP_003433424.1|Plus18445187..8445474 NW_876282 U6 snRNA-associated Sm-like protein LSm2-like LOC100686698 __SEG__ Chr26 {Canis lupus familiaris} MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVHYVQLPADEVDTQLLQDAARKEALQQKQ*
15 >lcl|XP_003433776.1|Plus1complement(3227933..3228778) NW_876291 ribonuclease P protein subunit p38-like isoform 1 LOC100683678 __SEG__ Chr2 {Canis lupus familiaris} MAAAPQAPGRGSIRKTRPLTVKTSLNNPYTICWTTLEREDMHFILQTLQDRFKSLGLQKIEDKKRKKKQFLKKQSPDKCSTEVDKSEDLKEKQPEDNEQGSGWTPVLVRR
QLAIGVNEVTRALERNELLLVLVCKSAKPAIITSHLIQLSSSRSVPACQVPRLSETLAPVIGLKCVLALGFRKDTTAFVEEVKAIIPRVPSLHVPWLHGQPKEAWENVDT
ESLESQDKEILETSFEDLSKHKKKLVEGQQAVVLQPLKIKKVIPNPSKIRKPPKSKKPTSK*
16 >lcl|XP_003434538.1|Plus1complement(22202677..22203354) NW_876311 U2 small nuclear ribonucleoprotein B' SNRPB2 __SEG__ Chr4 {Canis lupus familiaris} MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTHSDIISKMCGAFADKEKKKEKKKA
KTVEQTATTANKKPGQGTPNAANTQGNSTPNPQVPDYPPNYILFLNNLPEETNKMMLSMLFNQFPGFKEVCLVPGRHDIAFVEFENDGQAGAAGDALQGFKITPSHAMKI
TYAKK*
17 >lcl|XP_003434975.1|Plus1complement(1890278..1890544) NW_876323 U2 small nuclear ribonucleoprotein B'-like LOC100683259 __SEG__ Chr7 {Canis lupus familiaris} MDIRPNHTIYINNMNDKIKKEELKRSLYTLFSQFVHVVDIVALKTMKMREQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDF*
18 >lcl|XP_003435031.1|Plus1complement(24124860..24125339) NW_876323 U1 small nuclear ribonucleoprotein C-like LOC100683869 __SEG__ Chr7 {Canis lupus familiaris} MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTTAFQQGKIPPTPFSAPPPAGTMIPPPPSLPGPPRPGIMPAPHMGGPPMMPMMGPPP
PGMMPVGPAPGMKPPMGGHMPMMPGPPMMRPPACPMMLPTWPGMTRPDR*
19 >lcl|XP_003435076.1|Plus1complement(36891178..36891597) NW_876327 U6 snRNA-associated Sm-like protein LSm4-like LSM4 __SEG__ Chr8 {Canis lupus familiaris} MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRG
VFGGRGRGGIPGTGRGQPEKKPGRQAGKQ*
20 >lcl|XP_003435109.1|Plus1complement(64524099..64524377) NW_876327 small nuclear ribonucleoprotein E-like LOC100687289 __SEG__ Chr8 {Canis lupus familiaris} MAYHGQGQKVQKVMVQPINLIFRYWQNRSRIQMWLYKQVNMQIEGCIIGFVEYMDLVLDDAKEFHSKTKSRKQLGWIMLKGDNITLLQIVSN*
21 >lcl|XP_003435170.1|Plus113432096..13432371 NW_876327 small nuclear ribonucleoprotein E-like LOC100687873 __SEG__ Chr8 {Canis lupus familiaris} MAYRGQGQKLQKVMVQSINIIFRYLQNRSRIQVWLYEPVNMRIEGCIIGFDEYMNLVLDDAVEIHSKTKSRKQLGWIMLKGDITLLQSVSN*
22 >lcl|XP_003435635.1|Plus111485602..11485982 NW_879563 small nuclear ribonucleoprotein Sm D3-like LOC477554 __SEG__ ChrX {Canis lupus familiaris} MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNVPMLKSMKNKNQGSGAGRGKAAILKAQVAAR
GRGRGMGRGNIFQKRR*
23 >lcl|XP_003435656.1|Plus120275275..20275541 NW_879563 mRNA-decapping enzyme 1B-like LOC100684504 __SEG__ ChrX {Canis lupus familiaris} MNRLSMENRTEPITKALDFQLQDSFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAYQGAGAGNSPMILNSGEGKEVDIL*
24 >lcl|XP_531889.2|Plus1complement(6291163..6292773) NW_876253 SNW domain-containing protein 1-like LOC609035 __SEG__ Chr11 {Canis lupus familiaris} MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALTIQVDAEGKIKYDAIARQGQSKDK
VIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPQ
GPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQK
ARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQSLFNQSKGMDSGFAGGEDEIYNVYDQAWRGG
KDMAQNIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE*
25 >lcl|XP_532561.1|Plus15896627..5896998 NW_876259 LSM10, U7 small nuclear RNA associated LSM10 __SEG__ Chr15 {Canis lupus familiaris} MAVSHSVKERTISENSLIILLQGLQGQVTTVDLRDESVARGRIDNVDAFMNIRLANVTYTDRWGHQVELDDLFVTGRNVRYVHIPDDVNITATIEQQLQVIHRVRNFGSK
GQGRREFPSKKYK*
26 >lcl|XP_532566.2|Plus140735073..40737064 NW_879563 splicing factor, proline- and glutamine-rich-like LOC475340 __SEG__ ChrX {Canis lupus familiaris} MSRDPFRSRGGGGFHRRGGGRGRGGLHDFRSPPPGMGLNQSRGPMGPGPGQGGPKPPIPPPPPYQPPPPPQAPSKPVGAQGPWPAPGEGSAPPASGSARPATPPTSGAPA
GPGPTPRPPPLPAVTSAPPGAPQTAPPCGGVPTTPPQAGDPPPPPAGGPGPGPKQGPGPGGPKGGTMPGGPGLRTPGGLPTPWHRGGGAGAPRGGKRHPPYGQQHRQGPP
PRGRSEEEVHSEGFKASLSLLRRPGEKTYTQRCRLFVGNLPADITEDELKRLFAKYGEPGEVFINKGKGFGLIKLESRALAEIAKAELDDTPMRGRQLRVRFATHPAALS
VRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFASKPAARKAFERCGKGVFLLTTMPRPVIVEPLEQLDDEDGLPEKLAQRNPMYQNEREMPPRFAQYG
TLEYEYSQRWKSLDEMEKQQREQVEKIMKDAKDKLENEMEDAYHEHRANLLRQNLMRCQEELRRMEELHNQEMQKRKEMQLKQEEERRRREEEMMIRQREMEEQMRRQRE
ESYSRMGYMDPRERDMRMGGGRTMNMGDPYGSGGQKFPPQGGGGGIGYEANPGVPPATMSGSMMGSDMPTEHFGQGGVEPVGGQGPRGMGPGTPAGYGRGREEYKGPNKK
PQF*
27 >lcl|XP_534323.2|Plus1complement(293283..293705) NW_876277 NTF2-related export protein 1 NXT1 __SEG__ Chr24 {Canis lupus familiaris} MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFN
QNFILTAQASPSNTVWKIASDCFRFQDWAS*
28 >lcl|XP_534648.2|Plus1complement(6137386..6138126) NW_876282 U11/U12 small nuclear ribonucleoprotein 35 kDa protein-like SNRNP35 __SEG__ Chr26 {Canis lupus familiaris} MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYTPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGLSKGYAFIEYKEERSLIKAYR
DADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPIIKNDQYREGKREKRERSRSRERHWDSRTRDRDHDRNREKRWQEREPSRVW
LESDWERERDFRDDRAKGREKRDRSK*
29 >lcl|XP_537585.2|Plus14131847..4132827 NW_876331 ELAV-like protein 1-like LOC480466 __SEG__ Chr9 {Canis lupus familiaris} MSNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFLNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYI
SGLPRTMTQKDVEDTFSRFWRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRF
SPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK*
30 >lcl|XP_538537.1|Plus152296205..52297275 NW_876251 poly(rC)-binding protein 1 isoform 1 PCBP1 __SEG__ Chr10 {Canis lupus familiaris} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCGDAAGYPHATHDLEGPPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
31 >lcl|XP_538645.2|Plus1complement(16419424..16420356) NW_876253 heterogeneous nuclear ribonucleoprotein A0 isoform 1 HNRNPA0 __SEG__ Chr11 {Canis lupus familiaris} MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVA
EGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIHSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGGGGY
NSYGGYGGGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKGGGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF*
32 >lcl|XP_538895.2|Plus1complement(33582369..33582848) NW_879563 U1 small nuclear ribonucleoprotein C-like LOC481774 __SEG__ ChrX {Canis lupus familiaris} MLKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENMKDYYQKWMEEQAQRLIDKTTAAFQQGKIPPTPFSAPPPAEAMIPPPPSLPGPPRPGMMPAPHKGGPPMMPMMGPPP
PGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTQPDR*
33 >lcl|XP_539112.1|Plus1complement(4119496..4119849) NW_876255 small nuclear ribonucleoprotein Sm D2-like LOC481991 __SEG__ Chr13 {Canis lupus familiaris} MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCCNKKLLGRVKAFKRHCNMVLENVKEMWTKVPKSSKGKKKSKPVNKDHYISKMFLCGHSIIVVLR
KLLIAGK*
34 >lcl|XP_539822.2|Plus1complement(12907365..12908777) NW_876260 non-POU domain-containing octamer-binding protein-like isoform 2 LOC482706 __SEG__ Chr16 {Canis lupus familiaris} MQSNKTFNLEKQNHTPRKHHQHHHQQHHQQQQQQPPPPPIPANGQQASSQNEDLTIDLKSFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGF
GFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRP
VTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSSEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHN
QEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPEPATMMPDGTLGLTPPTTECFGQAATM
EGIGAIGGTPPAFNRAAPGAEFAPNKRCRY*
35 >lcl|XP_542193.1|Plus1complement(32020166..32021233) NW_876272 adenosine deaminase, tRNA-specific 3 ADAT3 __SEG__ Chr20 {Canis lupus familiaris} MDPAPGPVEQRGDEKTGSPEQEPERWQALPVLSEQQSQDVELVLAYAAPVLDKRQTSRLLKEVSAVHPLPAQPHLKRVRPSRDASRPHALEMLLCLAGPAAGTRSLAELL
PQPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDRQVTRALAGRLFSAQERTAMQGHMEQAVWAARQAAARGLRAVGAVVVDPSSGRVLATGHDCSNAASP
LLHATMVCIDLVAQGQGRGAYDLGPYPACSFVPAVTPQSVRVGSVRKLDEDGDMHDDSVPYVCTGYDLYITREPCAMCAMALVHSRVQRVFYGAPSPDGALGTRFRIHAR
PDLNHRFQVFRGVLEAQCRRLDPGA*
36 >lcl|XP_542254.3|Plus19181021..>9182055 NW_876273 U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2-like LOC485136 __SEG__ Chr21 {Canis lupus familiaris} MAAPGKMMFPEKPSREKYRAALRKAKRKKRRQELARLRDPGPSQQEEEDAFTEEQRLEEKLLEIERQKLHEAWLLREQKAQEDFRRKKEREEAARKWREEHERKLREEWD
AQQRRQRQEQEQRLQERRQREEAARRPLEQAGPGARLGNGAPWRNPEPPTGLRAPERDRADCPFYRKTGACRFGDRCSRRHDLPSSSPTLLVRSMFTTFGMEQCRRDDYD
PDAGLEDSEEDTYQHFRAFYDDVLPEFRAVGTVVQFKVSRNLEPHLRGNVYVQYRSEAECRAALSLFNGRWYAGRRLQCELCPVTRWKAAICGLSELRRCPRGRRCNFLH
VFRNPDDGFWRAYRD
37 >lcl|XP_544781.2|Plus1complement(38428644..38429198) NW_876294 U3 small nucleolar ribonucleoprotein protein IMP3 IMP3 __SEG__ Chr30 {Canis lupus familiaris} MVRKLKFHEQKLLKQVDFLNWEATDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDPFRVRASAALLDKLYALGLVPTRGSLALCDSVTASAFCRRR
LPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSRIRRHVLEYNEERDDFDLEA*
38 >lcl|XP_545491.1|Plus1complement(6885130..6885576) NW_876303 protein mago nashi homolog 2-like LOC488369 __SEG__ Chr36 {Canis lupus familiaris} MTMASDFYLHNYVGHKGKFGHEFLEFEFQPDGKRRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLI
DVNQSKYPEGLRVFYYLVQDLKCLVFSLIGLYFKIKPI*
39 >lcl|XP_546838.2|Plus1complement(10664436..10666736) NW_876316 ftsJ methyltransferase domain-containing protein 1-like FTSJD1 __SEG__ Chr5 {Canis lupus familiaris} MSKCRKPPLGSSPETFSPDVLADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTEFNTLLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVKKSVNAELCT
QAWCKFHEILCSFPLIPQEAFQDGKLNSLHLCEAPGAFIASLNHYLKSHRFPCDWSWVANTLNPYHEANDNLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKYLTGLQNF
VSNMATIHLITADGSFDCQGNPGEQEALVSSLHYCEVVTALMTLGSGGSFVLKMFTLFEHCSINLMYLLNCSFDQVHVFKPATSKAGNSEVYVVCLRYKGKEAIYPLLSK
MVLNFGTEMTQKALFPHHVIPESFLKRHEECCMFFHKYQLETISENIRLFQCMGKGEQTKLNNLRDCAVQYFMQKFQLKPLSRNNWLVKKSNIGCSTNTKWFGQRNRYFK
TYNERKMLESLSWKDKVAKGYFNSWAEEHAVYHSGQSSVLEGTASNLECHLWHILEGKKLPNVKCSPFCDGEILKALNEAIEKSLGGALNLDSKFWPKQQYYCPCHIFTE
DLIFSELFSLTTCLQDDQVVEPSNQIKCLLVGFPTLRDIKTHIPLEVQLLESAELMTFSCSLLHDGDPIYQQLFLDCLLHSLQQLHTGDVMILPVLSCFTRFMAGLIFVL
HSCFRFITFSCPTSSEPLKTCAVLLCVGYQDLPNPVFQYLQNVNELLSSLLKSDAPQQVLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHVIIQGEREEIIGSLQL*
40 >lcl|XP_546867.1|Plus115036013..15037596 NW_876316 probable ATP-dependent RNA helicase DDX28 DDX28 __SEG__ Chr5 {Canis lupus familiaris} MAVARPPRLLRLAARWLCAPRRDLAGRGPEEPLPVVRIPRALQQRQSGRRSSPRLVLARPGPLLISARRRELSQPARLTLGRWERAPLASRGWKNRRSRRDHFSIERAQH
EVPALRNLSSEGSFADLGLEPPVLRALKDAAPEVLRPTTVQSSTIPPLLRGRHILCAAETGSGKTLGYLLPLLQRLLGRPGLNPHSTPAPRGLVLVPSRELAEQVRAVAQ
PLGISLGLRVRELGGGHGMNRIRVQLSKQPPADVLVATPGALWKALKSHLVSLKQLSFLVLDEADTLLDESFLELVDYILQKSHIAEDPDDLKDPFNPKAQLVLVGATFP
EGVSQLLSKVASPDSLTTITSSKLHCIMPHVRQTFMRLKGAEKVTELVQILKQHDRAYRTGPSGTILVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPASMRAGIFQCFQ
KGSRDILLCTDIASRGLDSTHVELVVNYDFPLTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLGPQ*
41 >lcl|XP_548903.1|Plus1complement(20756305..20758101) NW_879562 probable ATP-dependent RNA helicase DDX52-like LOC491783 __SEG__ ChrX {Canis lupus familiaris} MDAHDLFRRLGVGAKFDVRHFSADAARFQVGKRKYDFDSSEVLQGLDFFGNKKSVPGECGASRTHQELQDEEKKEESLTERKREQNKKKRKMISEIISQEEGSTIQWTSS
VEAKIEDKKIKRENKLTSGKLENLRKEKINFFRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQTPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSI
PILMQLKQPTNKGFRALIISPTRELANQIHRELVKISEGTGFRIHMIHKAAVAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDLTSVEWLVVDESDKLFEDGKTGF
RDQLASIFLACTSHKVRRAMFSAIFAYDVEQWCKLNLDNVITVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKGFNPPVLVFVQSIERAKELFHELIYEGINVDV
IHADRTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGHKGKAVTFFTEDDKPLLRSVANVIQQAGCPVPEYIKGFQKLLSK
QKKKMIKKPLERESISTTPKYFLEKAKNKRKKVTAQNSKKKVTLEDKS*
42 >lcl|XP_548937.2|Plus1complement(31526587..31527675) NW_879562 poly(rC)-binding protein 1-like LOC491817 __SEG__ ChrX {Canis lupus familiaris} MDARVTESELNATLTIRLLMHRKEVGSIIGKKGESPKRFRKESGARINISEGNCPERIITLTGPTNAIFKAFVMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPAYQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRWGYAAGYPHAAGYPHDTHYL
EGPPLDAYSIQGQHTVSPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSNSPEVKGYWASLDASTQTTHEFTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSG
RQVTITGSAASISLAQYLINARLSSEKGMGCS*
43 >lcl|XP_549122.2|Plus119875112..19876260 NW_879563 polyadenylate-binding protein 5 PABPC5 __SEG__ ChrX {Canis lupus familiaris} MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFI
KNLDKSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNFGNDMDDEKLKEIFS
GYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSINGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPPGVPIYIKNLDETIDDEKLKEEFSSFGSISR
AKVMVEVGQGKGFGVVCFSSFEDATKAVDEMNGRTVGSKPLHVTLGQARCRW*
44 >lcl|XP_848697.1|Plus13668493..3669737 NW_876285 heterogeneous nuclear ribonucleoprotein F isoform 3 HNRNPF __SEG__ Chr28 {Canis lupus familiaris} MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELESEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADTAND
GFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLERMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDGEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQMMQGMGVSAQSTYSGLESQSVSGCYGAGYGGQNSMGGYD*
45 >lcl|XP_849762.1|Plus125791165..25792433 NW_876302 60S ribosomal protein L4-like isoform 2 LOC478348 __SEG__ Chr35 {Canis lupus familiaris} MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRR
WHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKA
FRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNP
YAKTMRRNTILRQAKNHKLRMDKAAAALEAKSEEKGVPGKKPTVGKKGKKTVGVKKPKKPVVGKKAAATKKPAADKKPAEKKPTTEEKKPAA*
46 >lcl|XP_849980.1|Plus1complement(7786556..7788061) NW_876255 splicing factor 3A subunit 3-like LOC607999 __SEG__ Chr13 {Canis lupus familiaris} METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEF
EELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQNEFEKK
WENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEY
VEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGI
PNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGLL*
47 >lcl|XP_850143.1|Plus11342285..1342683 NW_876327 G patch domain-containing protein 4-like LOC608133 __SEG__ Chr8 {Canis lupus familiaris} MSATPEIKSHGMKFAEEQLLKHGRTQGKGLGRNENGITQALRVTLKQDTHGVGHDPAKEFTDHWWDELFNRTAASLVVEAGQDGVRIKRLSKETGRRNHPKPNLLYQKFV
KLWSQAGRSGLQTGPESGASDS*
48 >lcl|XP_850171.2|Plus123234018..23235286 NW_876279 60S ribosomal protein L4-like isoform 2 LOC608310 __SEG__ Chr25 {Canis lupus familiaris} MACARPLISVYYEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKSNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGRGTHRSGQGAFGNMCRGGRMFAPTKTWCR
WHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKA
FRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNP
YAKTMRRNTILRQAKNHKLRMDQAAAALEAKSEEKGVLGKKPTVGKKGKKTVGVKKPKKPVVGKKAAATKKPAADKKPAEKKPTTEEKKPAA*
49 >lcl|XP_850352.1|Plus14701204..4701650 NW_876321 protein mago nashi homolog 2-like LOC608220 __SEG__ Chr6 {Canis lupus familiaris} MAMASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLI
DVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI*
50 >lcl|XP_851128.1|Plus1complement(35110066..35110545) NW_876307 U1 small nuclear ribonucleoprotein C-like LOC609498 __SEG__ Chr3 {Canis lupus familiaris} MPKFYCDYYDTYLTHESPSVRKTHCSGRKHKENVKDYYQKWMEEQTQSLINKTTTAFQQGKMPPTPFSAPPPAGAMIPPPPSLPGPPCPGMMQARHIGGPPMMPMMGPPP
PGMMPMGPVPGMRPPMGGHMPMMPGPPMMRPPAHPKMVPTWPGMTRPDR*
51 >lcl|XP_852208.2|Plus1complement(50905298..50905684) NW_879563 NHP2-like protein 1-like isoform 1 LOC609886 __SEG__ ChrX {Canis lupus familiaris} MTEADVNPKAYSLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAKPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGS
QLKQQIQSIQQSIERLLV*
52 >lcl|XP_852363.2|Plus113792646..13792927 NW_876321 protamine-3 PRM3 __SEG__ Chr6 {Canis lupus familiaris} MGSHCAKLGTGHSRGHESSMKKLMACVSQDNFSLSSEGEEEEEVEEEEEEEEEEEELPVQGKLLLMEAERQEEEGAEEDPVAQQSPEPKQTHS*
53 >lcl|XP_852482.2|Plus18879736..8881388 NW_876323 protein FAM71A-like LOC490282 __SEG__ Chr7 {Canis lupus familiaris} MNTESLLPYHTAQSGSGVGMFNTTMGKLQRQLHKGEYDIFKYAPIFESDFIQITKRGEVIDVHNRVRMVTVGIASTSPILPLPDVMLLARPAAGCEEHGRGQAAKGKGRK
AAKALELTRLLPLKFVRISIHDREKQQLRLKFATGRSCYLQLSPPLHGREDLFAHWEKLIYLLRPPVDSNSSTYAIPAGDMLCMPEFEEEDGRSAAGADFQGKGDQDQVS
IRSLHVVSEVAGATSAAFAGGEGPPRDAHKPSRSTHAAELALGSAAGATAAAAAAGTAAGFAAAIAAGTAAGALGVAITKPGGAPSASPKSAAAAVAGAAKTPGFPSDSS
TSLSPEPSKALAFAGAAGEAAQDAAAARLTQARRAGGAAEPAGRGRGRRRERRERREKERARRGSRRRRPADSRHKASGDKGPRKASSRASAGRRAAREDQERGRRSPGD
ARRAQPSGGHAPAATESRTSHRSGRSASTASSGSARKRLSRIGVFLRNVRANLATRTVASARRRGVDALAKTAEGGGMEAILEAAESGQLAGAGSGTHGILETVTFGAHS
*
54 >lcl|XP_852986.2|Plus121871408..21872676 NW_876284 60S ribosomal protein L4-like LOC610395 __SEG__ Chr27 {Canis lupus familiaris} MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRR
WHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRLRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKA
FRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNP
YAKTMRRNTILRQAKNHKLRMDKAAAALEAKSEEKGVPGKKPTVGKKGKKTVGVKKPKKPVVGKKAAATKKPAADKKPAEKKPTTEEKKPAA*
55 >lcl|XP_853582.1|Plus119550222..19550452 NW_876332 small nuclear ribonucleoprotein G-like LOC610135 __SEG__ Chr9 {Canis lupus familiaris} MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
56 >lcl|XP_854453.1|Plus128213037..28213312 NW_876332 U6 snRNA-associated Sm-like protein LSm5-like LOC610939 __SEG__ Chr9 {Canis lupus familiaris} MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITRLVPGGEGPEV*
57 >lcl|XP_856741.2|Plus1complement(4660036..4660920) NW_876324 heterogeneous nuclear ribonucleoprotein C-like 1-like isoform 3 LOC480188 __SEG__ Chr7 {Canis lupus familiaris} MASDVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVPKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFD
LDYDFQRDYYDRMYSYPARGPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSSKSGKLKGDDLQTIKKELTQIKQKVDSLLESLEKIEKEQSKQGVEMKNDK
SEEEQSSSSLKKDETNVKMESEGGADDSAEEGDRLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS*
58 >lcl|XP_861182.2|Plus124461734..24463128 NW_879563 heterogeneous nuclear ribonucleoprotein K isoform 7 HNRNPK __SEG__ ChrX {Canis lupus familiaris} METEQPEETFPNTETNGEFGKCPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALHTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEE
GLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHPTDRVVLIGGKPDRVVECIKIILDLISESPIKG
RAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDKMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPG
DRYDGMVGFSADETWDSAIDTWSPSEWQMVYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTISKDLAGSIIGKGGRRIKQVRHESGASIKIDEPLEGSEDRVITITGT
QDQIQNAPYLLQNSVKQYANVEGF*
59 >lcl|XP_861916.1|Plus126722263..26723612 NW_879563 heterogeneous nuclear ribonucleoprotein H2 isoform 3 HNRNPH2 __SEG__ ChrX {Canis lupus familiaris} MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTAND
GFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYN
SIGRGTGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGE
ADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQEN
SSDYQSNLA*
60 >lcl|XP_864182.2|Plus1complement(9653907..9654872) NW_876284 putative heterogeneous nuclear ribonucleoprotein A1-like 3-like isoform 3 LOC608729 __SEG__ Chr27 {Canis lupus familiaris} MSKSESPKEPEQLWKLFIKGLSSKTTDESLRSHCEQQGALMDCVVMRDPNTKHSRGFGFTTYATREDVDAVMNARPHKMDGRVVEPKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLKDYFFEQYEKIEVIEIMTDRGSGKKRGFAFVTFDDHDFVDKIVIQKCHPVNGHDHEVRKALSKQEMASASSSQRSRSGSGNFGGGRGGGFGGNDNFGHG
GNFSGRGGFSGSRGGGGYGSSGDGYNGFGNDGSNFGGGGSYNDFGYYKNQSSNFGPMKGGNLGGRSSGPFGGGGQYFAKLRNQGGYGGSRSSSNYGNGRRF*