SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau A    

ID / Description / Sequence
1 >lcl|NP_001014860.1|Plus1complement(514573..515817) NW_001494448 heterogeneous nuclear ribonucleoprotein F HNRNPF __SEG__ Chr28 {Bos taurus} MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADTAND
GFVRLRGLPFGCTKEEIIQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYI
GIVKQAGLERMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDGEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGE
ADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQMMQGMGVSTQSTYSGLESQSVSGCYGAGYGGQNSMGGYD*
2 >lcl|NP_001015565.1|Plus15395643..5396713 NW_001492959 poly(rC)-binding protein 1 PCBP1 __SEG__ Chr11 {Bos taurus} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
3 >lcl|NP_001069024.1|Plus1complement(591421..592158) NW_001493523 small nuclear ribonucleoprotein 35kDa (U11/U12) SNRNP35 __SEG__ Chr17 {Bos taurus} MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYTPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKDERSLLKAYR
DADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDQFREGKRERRERSRSRERHWDSRMRDHHDRGREKRWQEREPARAWP
EGDWERERDFRDDRVKGREKRDRSK*
4 >lcl|NP_001069273.1|Plus1446752..447174 NW_001493131 NTF2-related export protein 1 NXT1 __SEG__ Chr13 {Bos taurus} MASVDFKTYVDQACRAAEEFVNVYYSTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFN
QNFILTAQASPSNTVWKIASDCFRFQDWAC*
5 >lcl|NP_001069476.1|Plus1321594..322943 NW_001508735 heterogeneous nuclear ribonucleoprotein H2 HNRNPH2 __SEG__ ChrX {Bos taurus} MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTAND
GFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYN
SIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGE
ADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGISNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQEN
SSDYQSNLA*
6 >lcl|NP_001071400.1|Plus1complement(98038..98295) NW_001848867 RNA-binding Raly-like protein RALYL __SEG__ Chr14 {Bos taurus} MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARIIAGQPLG
7 >lcl|NP_001073056.1|Plus1591939..592493 NW_001494036 U3 small nucleolar ribonucleoprotein protein IMP3 IMP3 __SEG__ Chr21 {Bos taurus} MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDPFRVRSSAALLDKLYALGLVPTRGSLELCDFVTASSFCRRR
LPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLDA*
8 >lcl|NP_001077250.1|Plus11789967..1790335 NW_001494832 LSM10, U7 small nuclear RNA associated LSM10 __SEG__ Chr3 {Bos taurus} MEVSHSVKERTISENSLIILLQGLQGQVTTVDLRDESVAHGRIDNVDAFMNIRLAQVTYTDRWGHQVELDDLFVTGRNVRYVHIPDNVNITATIEQQLQVIHRVRYFGSK
GQGRQEFPSKNS*
9 >lcl|NP_001098892.1|Plus1complement(3333551..3335188) NW_001493595 DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 DDX28 __SEG__ Chr18 {Bos taurus} MALARQLRLLSLATRLLLAPQRDLTSRGPDEPLPVVRIPRGLQRRQEQRQSGQRSPLRPVLVRPGPLLISARRPELNQPARQTLGRWEAAPLVSRGWKHRRARQDYFSIE
RAQHEAPALRNLSSKGSFADLGLEPRVLSALQEAAPEVVRPTTVQSSTIPPLLRGRHILCAAETGSGKTLGYMLPLLQRLLGQPSLYTSRIPAPRGLVLVPSRELAEQVR
AVAQPLGSSLGLRVQELGGGHGMSRVRLQLSKHPPAEVLVATPGALWKALKGQLISLAQLSFLVLDEVDTLLDESFLELVDYILEKSHIAEGPADLKDPFNPKAQLVLVG
ATFPEGVGQLLSKVASLDSLTTITSSKLHCIMPHVKQTFMRLKGAEKVTELVQILKQHDRAHRTGSTGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPASMRAGIF
QSFQKGSRDILLCTDIASRGLDSTQVELVINYDFPLTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLGSSVSEPLHQETLLQQA*
10 >lcl|NP_777145.1|Plus12987484..2987630 NW_001493490 cleavage and polyadenylation specificity factor subunit 1 CPSF1 __SEG__ Chr17 {Bos taurus} MYAVYKQAHPPTGLEFSMYCNFFNNSERNLVVAGTSQLYVYRLNRDSEV
11 >lcl|XP_001250105.1|Plus13156775..3159069 NW_001493600 adrift-like FTSJD1 __SEG__ Chr18 {Bos taurus} MNKCRKQPLGSSPETFSPDVLADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTEFSAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCT
QAWCKFHEILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCDWNWVANTLNPYHEANDNLTMIMDDRLIANTLHCWYFGPDNTGDIMTLKYLTGLQNF
INSMGTIHLITADGSFDCQGNPGEQEALVSCLHYCEAVTALMTLGNGGSFVLKMFTLFEHCSINLMYLLNCSFDQVHIFKPATSKAGNSEVYVVCLYYKGRETIYPILSK
MVLNFGSEMTKKALFPHHMIPESFLRKHEECCTFFHKYQLETISENIRLFECMGKREQAKLNSLRDYAVQYFMQKFQLKPLSRNNWLVKKSNIGCSTNTKWFGQRSRYFK
TYNERKMLETLSWKDKVAKGYFNSWAEEHATYHPGQSSLLEGTAFNLECHLWQVLQGKKLPKVKCSPFCDGEILKALNESVEKSLGGALNFDLKFRPKQKHCCSCHVFSE
ELIFSELFSLTKCLQDHQDKEPSTQIKCLLVGFPALHNIKMPIPLEVRLLESAALMTFSCSLLHDGDPTYQQLFLDCVLHSLQQLHTGDVMILPILSCFTRFMAGLIFVL
HSCFRFITFSCPISSEPLKTCAVLLCVGYQDLPNPVFQYLQNVNELLRDLVNTEAPQQVLQFVPMEVLLKGALLDFLWDLNAAIAKRYLHLIIQGEREEIIGSL*
12 >lcl|XP_001250714.1|Plus142615..42845 NW_001494876 small nuclear ribonucleoprotein polypeptide G LOC782782 __SEG__ Chr4 {Bos taurus} MSKAHPPKLKKFMDKKLSLKLNGGRHVQGILWGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
13 >lcl|XP_001250794.1|Plus12191852..2192082 NW_001493651 small nuclear ribonucleoprotein polypeptide G SNRPG __SEG__ Chr19 {Bos taurus} MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
14 >lcl|XP_001251082.1|Plus1221059..222021 NW_001502147 heterogeneous nuclear ribonucleoprotein A1 isoform 2 HNRNPA1L2 __SEG__ Chr2 {Bos taurus} MSKSESPKEPEQLWKLFIGGLRFETIDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYTTVEEVDAAMNARPHKVDGRAVEPKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYGKIEVIEIMTDQGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCQVRKALSKQEMASASSSQRGRSGSGSFGGGRGGGFSGNDNFGRGG
NFSGRGGFGGSHGGGRYGGSGDGYNGFGNDGSNSGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
15 >lcl|XP_001252392.1|Plus1complement(1093890..1094132) NW_001494583 Sm protein F LOC784698 __SEG__ Chr2 {Bos taurus} MSLWKQTPSDFLKQITGRPVVVKLNSGVDYRGVLACLDGYMNIVLEQTEEYVNGQLKNTYGDAFIQGNNVLYISTQKRRM*
16 >lcl|XP_001253175.1|Plus11624619..1625581 NW_001494275 heterogeneous nuclear ribonucleoprotein A1 LOC787289 __SEG__ Chr25 {Bos taurus} MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVLMRDPNTKHSRGFGLVTYATVEEVDAAMNARPHKVDGRVGELKRAVSREDSQRPGAHLTVKKIFVG
GIKEDTEEHHLRDYFEQYRKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGG
NFSGRGGFGGSRGGGRYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPCGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF*
17 >lcl|XP_001254238.2|Plus1complement(2062843..2063928) NW_001494701 heterogeneous nuclear ribonucleoprotein A2/B1 LOC786604 __SEG__ Chr2 {Bos taurus} MKKASQSVPLERGKRENEQFCKLFIGDLSSETTEESLWDYYRQWGYLTDCVLIRDPASQKSRRFGFITFSSMAELDAAMAARPHFIDGKMVMPKRAVPREDHGKLGALIT
VKKLFVGGITEDMKEHHLRDYFEKYGKINAIEIVTDGQSGKKRGFGFITFDDHDPVDKIVLQKNHTINGHRAEVRKALSRQERQEGQHLRSRGEGDVGLGYFHGVGGNVG
AGRGRNFRGGAGGYGRGRQFGDGSHGYGGRAGGGSWGVRPGYGGGRGGCSGGGSADGYQDEGFRACYDNYGGRSYASRNDSDSGNQKQKPSKYDLLKSGKLRDSRNMGGS
YTGGNHDPGGSRGHGGYGEIRRWGPSQWPWA*
18 >lcl|XP_001254398.3|Plus1complement(587371..587775) NW_001494612 small nuclear ribonucleoprotein D1 polypeptide 16kDa SNRPD1 __SEG__ Chr2 {Bos taurus} MKLVRFLTKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIQGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGQGRGRGRGQ
GRGRGRGQGRGRGRGRGRGRGGPR*
19 >lcl|XP_001254483.1|Plus1complement(222672..223256) NW_001508825 splicing factor, arginine/serine-rich 2-like LOC786944 __SEG__ ChrX {Bos taurus} MNYSRPPPNVGDLISLKVDNLTDPISHSTLRCIFEKYGPISDVYILRDRFTQESRDFAFICFHDKHHAEEAMDALDGVMLDGHVLQVQMARHGRLLDFHQGRSQETPPQS
QERQSRSLRLGRCRRSSTRSRSPSQARSHFSRSKSPSRSCDNSPSSSRSSSTGSTKSSLESTSSSASTSRSRSRSLPPRRKYRS*
20 >lcl|XP_001254626.3|Plus12028012..2028839 NW_001495310 RNA-binding protein S1, serine-rich domain-like LOC787144 __SEG__ Chr7 {Bos taurus} MAPPPTRCKENSDEQSRDPSTDKAGPKESREKYCGRARTRKWSSASSGSSSSRSSSSSRSPSSCSTSSGSSSGSSSPSASSRSGRSSTSCSSSSSSSSSPGSLKPSWHRR
GKRQRSHSKQPERDEKEGRRHSPSPKPTKLHIARLTRNVTKDHIREIFSTFGRVRVIDMPVERMHPGLSDAYVEFETPDGAEKALKHMDGGQIDGQEIRAAAVPPLRRLS
PHRRMRSPPPRWRRSPSQRRRRSPSPWLRSQKRWRPRFPRRPLPRSRSSSSSSRR*
21 >lcl|XP_001255822.1|Plus1complement(1822420..1822698) NW_001493678 small nuclear ribonucleoprotein polypeptide E SNRPE __SEG__ Chr19 {Bos taurus} MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIRVWLYEQVNMRTEGSIIGFDECMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN*
22 >lcl|XP_001787544.1|Plus1complement(903221..908458) NW_001492961 hypothetical protein LOC100141098 __SEG__ Chr11 {Bos taurus} MKSVELTPGSQEQGMNCQELTSGLQGVKSGISAPESTKNFIPGPMLTSVKFSNLSPESQQQGVKHLEFTPEPKLQSTRHAKSSSVSLQQAIKPVELASESLFQRPKSEDL
TPRTSSQMMGSSEIIPRPGHHFIEHEEMIPKPMHQVPKSVSLTSIPIYQVTDSSKMAKSLAHQDTETIEKSVKLTQKPKGKAMKASGMPLKLDLQVPEFVDLTPVLRNQD
SKSLKLTPKKSHRILETLELLSQSGSQVKELHTGQLQQVVESEGMTSGPKDHTTETMGLTFKTKLKGEEFLGRSPKPINKTTDAERYSRPYPQAQESVEVISTQKLPRGE
SIALITKAFQDVPESSEMTEGIRYQVPGSIGLTSKRFLKAKPTGQVAGYAESAEVTTETWQQGEGKMKLTQSQNQSMKYSETAPGLLGQITEFMRISPKPLEQVTNSTKT
QLQVAQAIGVKPVAPIRVATPVKVTPGPPYQVVKSVTLTSWPNSQMVDCAELTSKPQDVRPSEFTSGLRLQNAKFKKLSTEPKYQTLKRMDLTGFQIVKTMGPPLQIVKS
EELAPGPIPQIAEPIGVGLKATNYLDLFPRLHLQEPVESIELTPRPNTEVKSAELTTQPTSTLEAPTVLNHKQGLQAVKSTGIKTGPPQVMESEDLNLSEVCQNKDSEEG
SSEEELQIGNYFSRFLNNSSDSLSSSSVRTSELDLWDSEMPQVSNVLDIKNLVTDILQPEESFIDLDTIQSSTFSLSLHNQPLAETAITVKNSNSEIPGVDVIPNERTKR
KHVEESESSLQRLSQHSPQDWRSPPKFFQAESGAQRARSWPVLGRQRNVWESRSSRPRLPRKYLSNMLMMGNVLGTTMERKLSSQTSLTERATEDTCQSIQNLFGVPAEL
MTCSERLLEKGQGTISQPSVVKNYIQRHTSCHGYEKKTPLRIWTRSSMPSIIQHYSGSRKRIKKKSKPCDISQEVIQYMPVSCTGSQPPAPAKSESSLNIFFARRDSVPM
EETENSHSDSQTRIFESQHSLKPSYLPQAKTDFSEQFQLLQDLQLKIAAKLLRSQIPPNVPPPLASGLVLKYPICLQCGRCSGFNCCHKLQAAFGPHLLIYPQLQLVSTP
EGHGEIRLHLGFRLRTGKRPQLPKYHRRDRPVTPRSLRSTSLRKAKGYTRASKSPTSTINFQSGSSQAPAPIEVRIRQRQYDSSSLIEKTEIREPGHYEFTQVHSLSESD
SESNQDEKWAKVRTKKTYDSKYPMKRIPKEVRSQNTKFYTNGRAIIQSSSRELPNQLRRKRTGASQTTAASLKRQPKKSSQPKFIQLLFQGLKQAIQAAHRIMALAGQKP
EDTTRSDYFWSSKTYLPKQKARDYCSTKDSKRHRMPTLKLRHSNSVTKQESTRWEETDQFRPAQQPKRDSSFQLRPKQLPKPTVSQRSTTLKNISTSQCLGPVQNESSSR
DKKNFNRNEISNQESKNFKPGIRVHAAGRLLQPGSLMKRTSHSHLKGKPTHKERNHQSFGFSRERTPCYSSGRSQYSPSERDQHSTSERSHRSTSERSHRSTSERSHRST
SERSHRSASERSHRSASERSHRSASGRSHRSASERSHHSASERSHRSASERSHRSASERSHRSASERSHPSPSQRSHHSLSERSYRAPSERRCRSPSERRCRSPSERRCR
SPSERSNRSLFEKLRRSSSERRGHSASERRQHKPSEGSRQSPSERSHNNPLKERLKHSSPRERPRHGLSKDFNSNSNTSPRDHTKNPQRRASLEA*
23 >lcl|XP_001787630.2|Plus1complement(982813..983136) NW_001494782 poly(rC) binding protein 1-like LOC781360 __SEG__ Chr3 {Bos taurus} MMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSRAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS*
24 >lcl|XP_001788072.1|Plus1309244..309642 NW_001495467 cleavage and polyadenylation specific factor 5-like LOC100140679 __SEG__ Chr8 {Bos taurus} MHSNIHSFFKLPGGELNPGEDEVEGLKHLMTEILGRQDGVLQDWVIDDCTGNWWRPNFEPPHYPYIPAHITKPKEHRKLFLVQLQEKALFAVPKNYKLAAAPLFELYDNA
PGYGPIISSLPQLLSRFNFIYN*
25 >lcl|XP_001790217.1|Plus1complement(852542..853036) NW_001495101 splicing factor, arginine/serine-rich 3 LOC786295 __SEG__ Chr5 {Bos taurus} MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPP
PRRRSPRRRSFSRSRSRSLSSDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK*
26 >lcl|XP_002684580.1|Plus1676133..676411 NW_001494275 small nuclear ribonucleoprotein polypeptide E LOC100294963 __SEG__ Chr25 {Bos taurus} MAYQGQGWNVQKGQVQPINLIFRCLQNRSRIQVWLYEQVNMWTEGCTIGFDEYMNLVLDDAEDIHSKTKSRKQLGRIMLKGDNITLLQSVSN*
27 >lcl|XP_002703176.1|Plus1complement(1188024..1188383) NW_001494318 small nuclear ribonucleoprotein D1 polypeptide 16kDa LOC100297793 __SEG__ Chr25 {Bos taurus} MKLARFLMKLSHETVTIELKNGTQVHGTITCVNVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVGVEPKVKSKKREAVAGRGRGRGRGRGRGR
GRGRGGPRR*
28 >lcl|XP_002705211.1|Plus11195835..1196062 NW_001495569 small nuclear ribonucleoprotein polypeptide G LOC100297108 __SEG__ Chr9 {Bos taurus} MNKAHPPKLKSMDKKVSLKLNGGRHVQGILQGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALEQV*
29 >lcl|XP_580324.3|Plus1760232..761350 NW_001495328 heterogeneous nuclear ribonucleoprotein A2/B1-like LOC538435 __SEG__ Chr7 {Bos taurus} MAQATKRAEKETSTSDPSERNKRDNEKFRKLFVGGLSSETTEETLWNYYRQWGYLTDCVVIRDPASQTSRRFAFVTFSSMAEVDAAMAARPHSIDGKRVAPKRAVPREDY
GIPGALVTVKKLFVCKIGEDTEKHHLRDYFGKYGKINAIEIISDRESGRKRGFGFVTFDDHDPVDKLVLQKYHTINGHHAEVRKALSRPEMQELQHSRIGRGGRKADFLY
LHGGGGNFGAGRGRDFREASDGSGSSGESGDGDHGYGGGPGGGSLRVSPGYGEGRGGCDGEGPGHGYQDRGCRAGYINYGGRNDGSQNCNNLGNYKQKPSKYELLKSGKL
SGRRNMGRSYGGANYCPGGHGGSGGYGETAMLSLLFGRGLTV*
30 >lcl|XP_581615.1|Plus1complement(507058..508263) NW_001494227 RNA binding motif protein 17 LOC505339 __SEG__ Chr24 {Bos taurus} MSLYNDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDERQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEK
VVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFLDEEDSRPRSQSSKAAIPPPVYEEQDRP
RSPTGPGNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSMEKTSKRGGKIIVGDATEKDAAKKSDSNPLTEILKCPTKVVLLRNMVGAGEVDEDLKVETKEEC
EKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKVVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV*
31 >lcl|XP_588593.2|Plus1553473..554621 NW_001508718 poly(A) binding protein, cytoplasmic 5 isoform 2 PABPC5 __SEG__ ChrX {Bos taurus} MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGIGNIFI
KNLDKSIDNRALFYLFSAFGSILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDKATFTNVFVKNFGDDMDDDKLKELFS
EYGPTESVKVIRDSSGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPPGVPIYIKNLDETIDDEKLKEEFSSFGSISR
AKVMVEVGQGKGFGVICFSSFEEATKAVDEMNGRIVGSKPLQVTLGQARRRW*
32 >lcl|XP_590414.4|Plus12114592..2115617 NW_001495328 heterogeneous nuclear ribonucleoprotein A2/B1 LOC512831 __SEG__ Chr7 {Bos taurus} MEKTWKSVPMRRQQKEAEQIRKLFIGGLSFQTTEESLRKYYQQWGELTDCVVLRDFASQRSRGCGFVTFSSVTEVDAAMAARPHSIDGRVLEPRRAIPREASGQRGAHWT
LKKLFVGGIKEDTEEHHLREYFEKYGKIDAIEIITDRQSGRKRGFGFVTFDDYDPVDKIVLQKYHAINGHHAEVRKALSIWEMQQVQGSRSRKRDPFDFSVSSSWGGNFG
RGPGTKFRGEADGYGNGPRSRDSCQGYGGGPGGGNFGGYPGYGGGGGEYAGRGPGYGNQWEFSGGGYGNNFGNYDQQPSNYGPMRNGNFGVGRNKAAPYGGGNYGPGGSG
GSGGYGGRSGY*
33 >lcl|XP_593096.3|Plus1complement(3080357..3081274) NW_001495368 heterogeneous nuclear ribonucleoprotein A0 HNRNPA0 __SEG__ Chr7 {Bos taurus} MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVA
EGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIHSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSY
GGYGGGGGGYNAYGGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF*
34 >lcl|XP_594772.3|Plus12091900..2092982 NW_001495328 heterogeneous nuclear ribonucleoprotein A2/B1-like LOC516616 __SEG__ Chr7 {Bos taurus} MAAASERAMEKTVKSVPVKREKKENEQIRKLFIGGLSSETTEESLKNYYQQWGELTDCVVIRGLASQKSRGFGFVTFSSVAEVDAAMAARPHSIDGRVVDPKRAVSREKS
EKQGSLVNVKKLFVGGIKEDTEEHHLREYFEKYGKIDAIEIITDRQSGKKRGFGFVTFDDYDPVDKIMLQKYHAINGHRAEVGKALSRQEMKEIQGPRSRKGGPFGFSVS
SNGGGNFGRGPGTKFRGEADGYGNGPESRDGCHGYGGGPGGGNFGGYPCYGGGNFGGYPCYGGGGGEYAGRRPGYGNQWEFSGGGYGNNFGNYDQQPSNYGPMRNGIFGV
GRNIVAPYGGGNYGPGGNGGSGGYGGGSGY*
35 >lcl|XP_599343.3|Plus11061470..1062072 NW_001508783 PABPC1L2B protein-like LOC521086 __SEG__ ChrX {Bos taurus} MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRLCRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIF
SAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDAMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATFR*
36 >lcl|XP_608002.2|Plus1192223..193215 NW_001495266 rRNA/tRNA 2-O-methyltransferase fibrillarin-like protein 1-like LOC529551 __SEG__ Chr7 {Bos taurus} MKSAVGLRRGGSGGRGGGGWGGGRGGGAGKGAGGDGGGPGGKGGFGARTRGFGGGRGRGRGGAGGDGRGDRGGGGQLRGVAKNKNRRRKSVLTVSVEPHRHEGVFIYRGA
EDALVTLNMVPGQSVYGERRVTVTEGGEKLEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTNIIP
VLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRPLPKSSSK
*
37 >lcl|XP_871569.1|Plus13506046..3507314 NW_001493651 60S ribosomal protein L4-like isoform 2 LOC507271 __SEG__ Chr19 {Bos taurus} MACARPLISVYSKKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGRTHHSGQGAFGNMCRGGRMFAPTKTWQR
WHHRVNTTQKRYAICSELAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKSKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRHRIQRRGPCIIYNEDNGIIKA
FRSIPGITLLNVSKLNILKLAPGGYVGRFCIWTESAFRKLDELYGTWCKAASLKSNYNHPMHKMLNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNP
YAKTMRRNTILRQARNHKIRMDKAAAAVEAKSDQKGVQGKKPVVGNKEKKAVGNKKLKKPVVGKNAEGTKKPAAEKKPTGKKPTSEEKKAAA*
38 >lcl|XP_873064.1|Plus167994..68707 NW_001493372 zinc finger, CCHC domain containing 17 LOC616011 __SEG__ Chr15 {Bos taurus} MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVCVKLIGREMKDDRIKVSLSMKVVDQGTVKDLDPNNVIIEQEER
RRWSFQDYTGQRITLEAVLNATCKKCGCKGHFAKDCFMQPGGAKYSLIPDEEEEKEEPKSAEFEKPDTTRNSSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTS
KDSKAAKKKKKKKKHKE*
39 >lcl|XP_874347.1|Plus1complement(104822..105475) NW_001495416 zinc finger CCHC-type and RNA binding motif 1-like LOC617072 __SEG__ Chr8 {Bos taurus} MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRRSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASIAIDNGRAAELIRRRNYFDKSKCYEC
GESGHLSYACPKNMLGEQEPPKKKEKKKKKKIPEPEEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEEQKKWKPSSGGPSTSDDSRCPRIKKSTYFSDEEELSD*